Rv3748 Family assigned · low auto-curated · to review

H37Rv Rv3748 · MTBC0 mtbc0_003971 · 119 aa · 4221358–4221717 (+) · RefSeq NP_218265.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)No Pfam domain above threshold; Foldseek indicates a fold similar to 1qvy-assembly3_C Crystal structure of RhoGDI K(199,200)R double mutant (prob 1.00, TM 0.60). Structure-based, putative.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed (flagged for human review).

Curated reference (UniProt)

UniProt O69715 TrEMBL · unreviewed · Evidence at protein level
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2AU2R

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 77.6 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
1qvy-assembly3_C 1.00 0.60 2.7e-03 sig 1qvy-assembly3_C Crystal structure of RhoGDI K(199,200)R double mutant
7k2t-assembly1_C 1.00 0.55 1.7e-03 sig 7k2t-assembly1_C Mg2+/ATP-bound structure of the full-length WzmWzt O antigen ABC transporter in lipid nanodiscs
8dnc-assembly1_C 1.00 0.59 5.4e-03 sig 8dnc-assembly1_C CryoEM structure of the A. aeolicus WzmWzt transporter bound to the native O antigen and ADP
8dne-assembly1_C 1.00 0.54 1.7e-03 sig 8dne-assembly1_C CryoEM structure of the A.aeolicus WzmWzt transporter bound to ATP
2jhw-assembly2_B 1.00 0.51 1.9e-03 sig 2jhw-assembly2_B CRYSTAL STRUCTURE OF RHOGDI E155A, E157A MUTANT
2jht-assembly2_B 1.00 0.58 1.2e-02 2jht-assembly2_B CRYSTAL STRUCTURE OF RHOGDI K135T,K138T,K141T MUTANT
6kn9-assembly2_B 1.00 0.54 5.6e-03 sig 6kn9-assembly2_B Crystal structure of human interleukin 18 receptor beta extracellular domain in complex with an antagonistic scFv
5fr2-assembly1_B 1.00 0.53 6.3e-03 sig 5fr2-assembly1_B Farnesylated RhoA-GDP in complex with RhoGDI-alpha, lysine acetylated at K178

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv3747 hyp hypothetical protein 578 579 ctx neighborhood:554

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 1qvy-assembly3_C Crystal structure of RhoGDI K(199,200)R double mutant (prob 1.00, E=3e-03, TM=0.60)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218265.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AU2R
  • Curated reference: UniProt O69715 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 77.6, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 1 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003971|Rv3748|
MIVGAFLAEAASVVDNKLNVSGGVLYRFAVDPDRSAQFLLVVLTQAETDDPDRRVDVEVWPPTGDDAHHIEFELPEAAVAAEVGFAIFRIEVNLPVDGRWVLVVTGGAGTISLPLIVTG