fadE36 Family assigned · medium auto-curated

H37Rv Rv3761c · MTBC0 mtbc0_003985 · 351 aa · 4229983–4231038 (-) · RefSeq NP_218278.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)acyl-CoA dehydrogenase FadE36
MTBC0 PGAP re-annotationphosphotransferase family protein
Revised (this work)Phosphotransferase family protein. Pfam: APH (PF01636.30).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O69727 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible acyl-CoA dehydrogenase FadE36

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namefadE36
eggNOG descriptionAminoglycoside phosphotransferase
Orthologous groupCOG3173

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.265 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 3 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.74% of strains (1076) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
APHPF01636.30 9.7e-4933–277 Phosphotransferase enzyme family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadE2 (acyl-CoA dehydrogenase FadE2), high confidence from genomic context alone (score 981 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0154c fadE2 acyl-CoA dehydrogenase FadE2 981 981 ctx fusion:900 cooccurence:774
Rv0131c fadE1 acyl-CoA dehydrogenase FadE1 977 977 ctx fusion:899 cooccurence:725
Rv2766c short-chain type dehydrogenase/reductase 703 692 ctx neighborhood:544
Rv3168 aminoglycoside phosphotransferase 676 676 ctx cooccurence:674
Rv3762c hydrolase 586 586 ctx neighborhood:559
Rv0130 htdZ 3-hydroxyl-thioester dehydratase 572 556
Rv0215c fadE3 Rv0215c, (MTCY08D5.10c), len: 357 aa. Probable fadE3, acyl- dehydrogenase, similar to many e.g. ACDB_BACSU|P45857 acyl-CoA dehydrogenase fro 567 551 ctx fusion:444
Rv3141 fadB4 NADPH quinone oxidoreductase FadB 478 479
Rv0149 quinone oxidoreductase 477 478
Rv2605c tesB2 acyl-CoA thioesterase II 496 477 ctx cooccurence:426
Rv1618 tesB1 acyl-CoA thioesterase II 469 450
Rv0163 hyp hypothetical protein 443 443 ctx cooccurence:420
Rv1771 L-gulono-1,4-lactone dehydrogenase 409 409
Rv0672 fadE8 acyl-CoA dehydrogenase FadE8 427 406
Rv0632c echA3 enoyl-CoA hydratase EchA3 404 382

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: acyl-CoA dehydrogenase FadE36
  • MTBC0 PGAP product: phosphotransferase family protein
  • Pfam (hmmscan --cut_ga): APH PF01636.30 (E=1e-48)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218278.1)
  • Domains: Pfam-A via hmmscan --cut_ga — APH (PF01636.30)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3173
  • Curated reference: UniProt O69727 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 17 functional partner(s); context anchor fadE2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003985|Rv3761c|fadE36
MTSVDRLDGLDLGALDRYLRSLGIGRDGELRGELISGGRSNLTFRVYDDASSWLVRRPPLHGLTPSAHDMAREYRVVAALGDTPVPVARTISLCQDDSVLGAPFQVVEFVAGQVVRRRAELEALGSRSVIEGCVDALIRVLVDLHSIDPKAVGLSDFGKPDGYLERQVRRWGSQWELVRLPDDHRDADISRLHLALQQAIPQQSRTSIVHGDYRIDNTILDTDDPCHVRAVVDWELSTLGDPLSDAALMCVYRDPALDLIVHAQAAWTSPLLPAADELADRYSLVSGQPLGHWEFYMALAYFKLAIIAAGIDYRRRMSEQAEGKDTAAESVPDVVAPLIARGLAEIAKKSG