fadE36 Family assigned · medium auto-curated
H37Rv Rv3761c · MTBC0 mtbc0_003985 ·
351 aa · 4229983–4231038 (-) ·
RefSeq NP_218278.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | acyl-CoA dehydrogenase FadE36 |
|---|---|
| MTBC0 PGAP re-annotation | phosphotransferase family protein |
| Revised (this work) | Phosphotransferase family protein. Pfam: APH (PF01636.30). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O69727
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible acyl-CoA dehydrogenase FadE36 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | fadE36 |
| eggNOG description | Aminoglycoside phosphotransferase |
| Orthologous group | COG3173 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.265 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 3 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.74% of strains (1076) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
APH | PF01636.30 | 9.7e-49 | 33–277 | Phosphotransferase enzyme family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: fadE2 (acyl-CoA dehydrogenase FadE2), high confidence from genomic context alone (score 981 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0154c fadE2 |
acyl-CoA dehydrogenase FadE2 | 981 | 981 ctx | fusion:900 cooccurence:774 |
Rv0131c fadE1 |
acyl-CoA dehydrogenase FadE1 | 977 | 977 ctx | fusion:899 cooccurence:725 |
Rv2766c |
short-chain type dehydrogenase/reductase | 703 | 692 ctx | neighborhood:544 |
Rv3168 |
aminoglycoside phosphotransferase | 676 | 676 ctx | cooccurence:674 |
Rv3762c |
hydrolase | 586 | 586 ctx | neighborhood:559 |
Rv0130 htdZ |
3-hydroxyl-thioester dehydratase | 572 | 556 | |
Rv0215c fadE3 |
Rv0215c, (MTCY08D5.10c), len: 357 aa. Probable fadE3, acyl- dehydrogenase, similar to many e.g. ACDB_BACSU|P45857 acyl-CoA dehydrogenase fro | 567 | 551 ctx | fusion:444 |
Rv3141 fadB4 |
NADPH quinone oxidoreductase FadB | 478 | 479 | |
Rv0149 |
quinone oxidoreductase | 477 | 478 | |
Rv2605c tesB2 |
acyl-CoA thioesterase II | 496 | 477 ctx | cooccurence:426 |
Rv1618 tesB1 |
acyl-CoA thioesterase II | 469 | 450 | |
Rv0163 hyp |
hypothetical protein | 443 | 443 ctx | cooccurence:420 |
Rv1771 |
L-gulono-1,4-lactone dehydrogenase | 409 | 409 | |
Rv0672 fadE8 |
acyl-CoA dehydrogenase FadE8 | 427 | 406 | |
Rv0632c echA3 |
enoyl-CoA hydratase EchA3 | 404 | 382 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: acyl-CoA dehydrogenase FadE36
- MTBC0 PGAP product: phosphotransferase family protein
- Pfam (hmmscan --cut_ga): APH PF01636.30 (E=1e-48)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218278.1)
- Domains: Pfam-A via hmmscan --cut_ga — APH (PF01636.30)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3173 - Curated reference: UniProt O69727 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
17 functional partner(s); context anchor
fadE2 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003985|Rv3761c|fadE36 MTSVDRLDGLDLGALDRYLRSLGIGRDGELRGELISGGRSNLTFRVYDDASSWLVRRPPLHGLTPSAHDMAREYRVVAALGDTPVPVARTISLCQDDSVLGAPFQVVEFVAGQVVRRRAELEALGSRSVIEGCVDALIRVLVDLHSIDPKAVGLSDFGKPDGYLERQVRRWGSQWELVRLPDDHRDADISRLHLALQQAIPQQSRTSIVHGDYRIDNTILDTDDPCHVRAVVDWELSTLGDPLSDAALMCVYRDPALDLIVHAQAAWTSPLLPAADELADRYSLVSGQPLGHWEFYMALAYFKLAIIAAGIDYRRRMSEQAEGKDTAAESVPDVVAPLIARGLAEIAKKSG