Rv3733c Family assigned · medium auto-curated

H37Rv Rv3733c · MTBC0 mtbc0_003958 · 166 aa · 4208133–4208633 (-) · RefSeq NP_218250.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationNUDIX domain-containing protein
Revised (this work)NUDIX domain-containing protein. Pfam: NUDIX (PF00293.35).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O69700 TrEMBL · unreviewed · Predicted
UniProt nameNudix hydrolase domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionpfam nudix
Orthologous groupCOG4119

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NUDIXPF00293.35 6.2e-152–147 NUDIX domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: tgs2 (diacyglycerol O-acyltransferase), high confidence from genomic context alone (score 907 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3734c tgs2 diacyglycerol O-acyltransferase 906 907 ctx neighborhood:847 coexpression:415
Rv2296 dhmA1 haloalkane dehalogenase 546 546 ctx neighborhood:544
Rv3735 hyp hypothetical protein 534 533 ctx neighborhood:526
Rv0938 ligD multifunctional non-homologous end joining DNA repair protein/ATP dependent DNA ligase LigD 421 421
Rv3737 transmembrane protein 401 401

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: NUDIX domain-containing protein
  • Pfam (hmmscan --cut_ga): NUDIX PF00293.35 (E=6e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218250.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NUDIX (PF00293.35)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4119
  • Curated reference: UniProt O69700 (TrEMBL, unreviewed; Predicted)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 5 functional partner(s); context anchor tgs2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003958|Rv3733c|
MPKLSAGVLLYRARAGVVDVLLAHPGGPFWAGKDDGAWSIPKGEYTGGEDPWLAARREFSEEIGLCVPDGPRIDFGSLKQSGGKVVTVFGVRADLDITDARSSTFELDWPKGSGKMRKFPEVDRVSWFPVARARTKLLKGQRGFLDRLMAHPAVAGLSEGPESLPR