Rv3747 Still unknown · low

H37Rv Rv3747 · MTBC0 mtbc0_003970 · 127 aa · 4220845–4221228 (+) · RefSeq NP_218264.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical; function unknown. Structure-based hint rejected: the real Wzm/Wzt galactan-export ABC transporter is Rv3781/Rv3783 (paralogue-of-fold).

Curated reference (UniProt)

UniProt O69714 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2AU2R

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 75.6 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
8dne-assembly1_C 1.00 0.52 1.2e-03 sig 8dne-assembly1_C CryoEM structure of the A.aeolicus WzmWzt transporter bound to ATP
8dnc-assembly1_C 1.00 0.54 4.8e-03 sig 8dnc-assembly1_C CryoEM structure of the A. aeolicus WzmWzt transporter bound to the native O antigen and ADP
7k2t-assembly1_C 1.00 0.49 4.3e-03 sig 7k2t-assembly1_C Mg2+/ATP-bound structure of the full-length WzmWzt O antigen ABC transporter in lipid nanodiscs
3wnn-assembly2_B 1.00 0.55 1.7e-02 3wnn-assembly2_B D308A mutant of Bacillus circulans T-3040 cycloisomaltooligosaccharide glucanotransferase complexed with isomaltooctaose
7ptr-assembly1_A 1.00 0.62 5.5e-02 7ptr-assembly1_A Structure of hexameric S-layer protein from Haloferax volcanii archaea
1qvy-assembly3_C 0.99 0.56 3.8e-02 1qvy-assembly3_C Crystal structure of RhoGDI K(199,200)R double mutant
3hs0-assembly1_G 0.99 0.42 4.3e-03 sig 3hs0-assembly1_G Cobra Venom Factor (CVF) in complex with human factor B
1ds6-assembly1_B 0.99 0.53 3.6e-02 1ds6-assembly1_B CRYSTAL STRUCTURE OF A RAC-RHOGDI COMPLEX

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PE34 (PE family protein PE34), medium confidence from genomic context alone (score 542 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3745c hyp hypothetical protein 651 652 ctx neighborhood:652
Rv3748 hyp hypothetical protein 578 579 ctx neighborhood:554
Rv3746c PE34 PE family protein PE34 542 542 ctx neighborhood:542

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Structural Foldseek hit not propagated -- the real Wzm/Wzt galactan-export ABC transporter is Rv3781/Rv3783 (paralogue-of-fold)
  • Reviewed against literature (extended structural cross-check, 2026-06-02)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218264.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AU2R
  • Curated reference: UniProt O69714 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 75.6, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 3 functional partner(s); context anchor PE34
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003970|Rv3747|
MILTGAFLADAAAAVDNKLNVQGGVLSRFAVGPDRLARFVLVVLTQAEPDSSDRDITVEMRPPTDDEPIRLNFEAPEAAVAEFPGFAFFEIQLRLPVNGRWVLVVTGGTGAISLPVLVSDMPATIGF