Rv3747 Still unknown · low
H37Rv Rv3747 · MTBC0 mtbc0_003970 ·
127 aa · 4220845–4221228 (+) ·
RefSeq NP_218264.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical; function unknown. Structure-based hint rejected: the real Wzm/Wzt galactan-export ABC transporter is Rv3781/Rv3783 (paralogue-of-fold). |
Curated reference (UniProt)
| UniProt |
O69714
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2AU2R |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 75.6 (confident). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
8dne-assembly1_C |
1.00 | 0.52 | 1.2e-03 sig | 8dne-assembly1_C CryoEM structure of the A.aeolicus WzmWzt transporter bound to ATP |
8dnc-assembly1_C |
1.00 | 0.54 | 4.8e-03 sig | 8dnc-assembly1_C CryoEM structure of the A. aeolicus WzmWzt transporter bound to the native O antigen and ADP |
7k2t-assembly1_C |
1.00 | 0.49 | 4.3e-03 sig | 7k2t-assembly1_C Mg2+/ATP-bound structure of the full-length WzmWzt O antigen ABC transporter in lipid nanodiscs |
3wnn-assembly2_B |
1.00 | 0.55 | 1.7e-02 | 3wnn-assembly2_B D308A mutant of Bacillus circulans T-3040 cycloisomaltooligosaccharide glucanotransferase complexed with isomaltooctaose |
7ptr-assembly1_A |
1.00 | 0.62 | 5.5e-02 | 7ptr-assembly1_A Structure of hexameric S-layer protein from Haloferax volcanii archaea |
1qvy-assembly3_C |
0.99 | 0.56 | 3.8e-02 | 1qvy-assembly3_C Crystal structure of RhoGDI K(199,200)R double mutant |
3hs0-assembly1_G |
0.99 | 0.42 | 4.3e-03 sig | 3hs0-assembly1_G Cobra Venom Factor (CVF) in complex with human factor B |
1ds6-assembly1_B |
0.99 | 0.53 | 3.6e-02 | 1ds6-assembly1_B CRYSTAL STRUCTURE OF A RAC-RHOGDI COMPLEX |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: PE34 (PE family protein PE34), medium confidence from genomic context alone (score 542 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3745c hyp |
hypothetical protein | 651 | 652 ctx | neighborhood:652 |
Rv3748 hyp |
hypothetical protein | 578 | 579 ctx | neighborhood:554 |
Rv3746c PE34 |
PE family protein PE34 | 542 | 542 ctx | neighborhood:542 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Structural Foldseek hit not propagated -- the real Wzm/Wzt galactan-export ABC transporter is Rv3781/Rv3783 (paralogue-of-fold)
- Reviewed against literature (extended structural cross-check, 2026-06-02)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218264.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2AU2R - Curated reference: UniProt O69714 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 75.6, confident)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
3 functional partner(s); context anchor
PE34 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003970|Rv3747| MILTGAFLADAAAAVDNKLNVQGGVLSRFAVGPDRLARFVLVVLTQAEPDSSDRDITVEMRPPTDDEPIRLNFEAPEAAVAEFPGFAFFEIQLRLPVNGRWVLVVTGGTGAISLPVLVSDMPATIGF