proZ Family assigned · medium auto-curated
H37Rv Rv3756c · MTBC0 mtbc0_003980 ·
239 aa ·
4226015–4226734 MTBC0
(-) ·
RefSeq NP_218273.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | glycine betaine/carnitine/choline/L-proline ABC transporter permease ProZ |
|---|---|
| MTBC0 PGAP re-annotation | glycine betaine/carnitine/choline/L-proline ABC transporter permease ProZ |
| Revised (this work) | Glycine betaine/carnitine/choline/L-proline ABC transporter permease ProZ. Pfam: BPD_transp_1 (PF00528.28). |
| Functional category (TubercuList) | virulence, detoxification, adaptation |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 5 publications
5 TB publications mention this gene. 5 publication(s) discuss this gene (5 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Comparative transcriptomic profiling of pyrazinamide resistance in Mycobacterium tuberculosis. doi:10.1093/jambio/lxag064 | 2026 |
| Mycobacterium tuberculosis Gene Expression Associated With Fluoroquinolone Resistance and Efflux Pump Inhibition. doi:10.1093/infdis/jiad112 | 2023 |
| In vivo evolution of drug-resistant Mycobacterium tuberculosis in patients during long-term treatment. doi:10.1186/s12864-018-5010-5 | 2018 |
| Identification of Novel Efflux Proteins Rv0191, Rv3756c, Rv3008, and Rv1667c Involved in Pyrazinamide Resistance in Mycobacterium tuberculosis. doi:10.1128/AAC.00940-17 | 2017 |
| Serum amyloid A, protein Z, and C4b-binding protein β chain as new potential biomarkers for pulmonary tuberculosis. doi:10.1371/journal.pone.0173304 | 2017 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | proW (Rv3757c, - strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Peptidoglycan Biosynthesis.
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.84 (95% CI -2.02 to 4.28). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Thought to be involved in active transport of osmoprotectant (glycine betaine/carnitine/choline/L-proline) across the membrane (import). Responsible for the translocation of the substrate across the membrane. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3782c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_5299
· 80.6% identity |
| M. smegmatis |
MSMEG_6331
· 77.4% identity |
| M. orygis |
RJtmp_003864
· 100.0% identity |
| M. abscessus |
MAB_0264
· 71.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O69722
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible osmoprotectant |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | proZ |
| eggNOG description | inner membrane component |
| Orthologous group | COG1174 |
| KEGG orthology |
K05846
|
| KEGG pathways |
map02010
|
| KEGG modules |
M00209
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.136 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 80.5%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 5/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 55.4% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 17 in the ORF — 0 in the essential state, 0 growth-defect, 17 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 86.6470588235. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 7 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 4.72 ppm · rank 2958/3519 (16.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (5 TM helixes) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 5 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 239 aa |
|---|---|
| Molecular weight | 24.2 kDa |
| Theoretical pI | 9.57 |
| GRAVY | 0.933 (hydrophobic) |
| Aliphatic index | 136.4 |
| Aromaticity | 0.042 |
| Instability index | 24.4 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
BPD_transp_1 | PF00528.28 | 3.5e-16 | 45–207 | Binding-protein-dependent transport system inner membrane component |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 90.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
7ahd-assembly1_B |
1.00 | 0.80 | 4.4e-08 sig | 7ahd-assembly1_B OpuA (E190Q) occluded |
7ahd-assembly1_A |
1.00 | 0.79 | 2.8e-07 sig | 7ahd-assembly1_A OpuA (E190Q) occluded |
7ahh-assembly1_B |
1.00 | 0.85 | 1.4e-06 sig | 7ahh-assembly1_B OpuA inhibited inward-facing, SBD docked |
7ahc-assembly1_B |
1.00 | 0.76 | 3.6e-07 sig | 7ahc-assembly1_B OpuA apo inward-facing |
7ahh-assembly1_A |
1.00 | 0.81 | 7.9e-06 sig | 7ahh-assembly1_A OpuA inhibited inward-facing, SBD docked |
Foldseek search of the AlphaFold DB model (mean pLDDT 90.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 5
| Upstream (5' on genome) | Rv3755c (- strand, 5 bp gap) |
|---|---|
| Downstream (3' on genome) | proW (- strand, -4 bp gap) |
| Predicted operon |
Rv3755c · proZ · proW · proV · proX
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (3 TF) |
Rv0043c (represses) · Rv0273c (represses) · mmpR5 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: proV (glycine betaine/carnitine/choline/L-proline ABC transporter ATP-binding protein ProV), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3758c proV exp |
glycine betaine/carnitine/choline/L-proline ABC transporter ATP-binding protein ProV | 999 | 1000 ctx | neighborhood:881 cooccurence:772 coexpression:869 database:900 textmining:699 |
Rv3759c proX exp |
glycine betaine/carnitine/choline/L-proline ABC transporter substrate-binding lipoprotein ProX | 999 | 999 ctx | neighborhood:881 fusion:511 cooccurence:774 coexpression:527 database:800 textmining:580 |
Rv3757c proW exp |
glycine betaine/carnitine/choline/L-proline ABC transporter permease ProW | 998 | 998 ctx | neighborhood:881 coexpression:805 database:900 |
Rv3755c hyp |
hypothetical protein | 883 | 883 ctx | neighborhood:881 |
Rv3760 |
membrane protein | 769 | 769 ctx | neighborhood:768 |
Rv1244 lpqZ |
lipoprotein LpqZ | 783 | 762 ctx | cooccurence:469 coexpression:516 |
Rv2502c accD1 |
acetyl-/propionyl-CoA carboxylase subunit beta | 448 | 73 | textmining:430 |
Rv0191 |
MFS-type transporter | 661 | 64 | textmining:653 |
Rv0404 fadD30 |
long-chain-fatty-acid--AMP ligase FadD30 | 439 | 53 | textmining:432 |
Rv1667c |
Rv1667c, (MTV047.03c), len: 217 aa. Probable second part of macrolide-transport ATP-binding protein ABC transporter (see citation below), wi | 659 | 51 | textmining:656 |
Rv3008 hyp |
hypothetical protein | 809 | 44 | textmining:809 |
Rv0323c hyp |
hypothetical protein | 631 | 44 | textmining:630 |
Rv2080 lppJ |
lipoprotein LppJ | 517 | 44 | textmining:516 |
Rv0565c |
monooxygenase | 512 | 44 | textmining:511 |
Rv3601c panD |
aspartate 1-decarboxylase | 438 | 44 | textmining:437 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: glycine betaine/carnitine/choline/L-proline ABC transporter permease ProZ
- MTBC0 PGAP product: glycine betaine/carnitine/choline/L-proline ABC transporter permease ProZ
- Pfam (hmmscan --cut_ga): BPD_transp_1 PF00528.28 (E=4e-16)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218273.1)
- Domains: Pfam-A via hmmscan --cut_ga — BPD_transp_1 (PF00528.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1174 - Curated reference: UniProt O69722 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 90.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
16 functional partner(s); context anchor
proV - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003980|Rv3756c|proZ MNFLQQALSYLLTASNWTGPVGLAVRTCEHLEYTAVAVAASALIAVPVGLLIGHTGRGTLLVVGAVNGLRALPTLGVLLLGVLLFGLGLGPPLVALMLLGIPSLLASTYAGIASVDPLVVDAARAMGMTESQVLLRVEVPNALPLMLGGLRSATLQVVATATVAAYASLGGLGGYLIDGIKERRFHIALVGAMMVAALALTLDGLLALAGWVSVPGTGRMRKLAAVVDKPAAGGGHALR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for proZ? Email the maintainer — the message is pre-filled with this gene's details.