TB18.5 Family assigned · medium auto-curated
H37Rv Rv0164 · MTBC0 - ·
161 aa · 193626–194111 (+) ·
RefSeq YP_177617.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Contains Polyketide_cyc2 (PF10604.16), Polyketide_cyc (PF03364.26) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
L7N657
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein TB18.5 |
UniProt still lists this protein as Conserved protein TB18.5; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| eggNOG description | Cyclase dehydrase |
| Orthologous group | COG2867 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.221 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Polyketide_cyc2 | PF10604.16 | 5.6e-07 | 17–156 | Polyketide cyclase / dehydrase and lipid transport |
Polyketide_cyc | PF03364.26 | 7.9e-11 | 25–152 | Polyketide cyclase / dehydrase and lipid transport |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: adhE1 (zinc-type alcohol dehydrogenase subunit E), high confidence from genomic context alone (score 742 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0163 hyp |
hypothetical protein | 809 | 809 ctx | neighborhood:807 |
Rv0162c adhE1 |
zinc-type alcohol dehydrogenase subunit E | 742 | 742 ctx | neighborhood:742 |
Rv0854 hyp |
hypothetical protein | 658 | 659 ctx | cooccurence:655 |
Rv3810 pirG |
cell surface protein | 642 | 643 ctx | cooccurence:636 |
Rv3287c rsbW |
anti-sigma factor RsbW | 622 | 622 ctx | cooccurence:621 |
Rv0273c |
transcriptional regulator | 605 | 605 ctx | cooccurence:604 |
Rv0518 hyp |
hypothetical protein | 527 | 527 ctx | cooccurence:515 |
Rv3058c |
TetR family transcriptional regulator | 507 | 508 ctx | cooccurence:502 |
Rv0857 hyp |
hypothetical protein | 487 | 488 ctx | cooccurence:486 |
Rv3446c hyp |
hypothetical protein | 487 | 487 ctx | cooccurence:480 |
Rv0856 hyp |
hypothetical protein | 477 | 478 ctx | cooccurence:476 |
Rv0009 ppiA |
iron-regulated peptidyl-prolyl cis-trans isomerase PpiA | 474 | 474 | coexpression:474 |
Rv0138 hyp |
hypothetical protein | 463 | 464 ctx | cooccurence:461 |
Rv0227c |
membrane protein | 453 | 453 ctx | cooccurence:425 |
Rv2905 lppW |
lipoprotein LppW | 451 | 451 ctx | cooccurence:448 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): Polyketide_cyc2 PF10604.16 (E=6e-07), Polyketide_cyc PF03364.26 (E=8e-11)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177617.1)
- Domains: Pfam-A via hmmscan --cut_ga — Polyketide_cyc2 (PF10604.16), Polyketide_cyc (PF03364.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2867 - Curated reference: UniProt L7N657 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
22 functional partner(s); context anchor
adhE1 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0164|TB18.5 MTAISCSPRPRYASRMPVLSKTVEVTADAASIMAIVADIERYPEWNEGVKGAWVLARYDDGRPSQVRLDTAVQGIEGTYIHAVYYPGENQIQTVMQQGELFAKQEQLFSVVATGAASLLTVDMDVQVTMPVPEPMVKMLLNNVLEHLAENLKQRAEQLAAS