Rv1904 Resolved · high auto-curated

H37Rv Rv1904 · MTBC0 mtbc0_002019 · 143 aa · 2169064–2169495 (+) · RefSeq NP_216420.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationanti-sigma factor antagonist
Revised (this work)Anti-sigma factor antagonist. Pfam: STAS (PF01740.27), STAS_2 (PF13466.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07728 TrEMBL · unreviewed · Evidence at protein level
UniProt nameAnti-sigma factor antagonist

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
eggNOG descriptionSTAS domain
Orthologous groupCOG1366

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.451 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
STASPF01740.27 8.6e-2231–135 STAS domain
STAS_2PF13466.13 2.3e-0734–126 Mlab, STAS domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0497 (transmembrane protein), medium confidence from genomic context alone (score 677 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1364c sigma factor regulatory protein 996 996 coexpression:928 experimental:912
Rv3287c rsbW anti-sigma factor RsbW 913 877 coexpression:509 experimental:658
Rv1752 hyp hypothetical protein 750 750 ctx cooccurence:748
Rv1354c hyp hypothetical protein 758 743 coexpression:649
Rv2079 hyp hypothetical protein 739 740 ctx cooccurence:736
Rv2423 hyp hypothetical protein 708 709 ctx cooccurence:708
Rv3899c hyp hypothetical protein 688 688 ctx cooccurence:627
Rv0497 transmembrane protein 677 677 ctx cooccurence:675
Rv0048c membrane protein 670 670 ctx cooccurence:667
Rv1173 fbiC FO synthase 658 659 coexpression:648
Rv0655 mkl ABC transporter ATP-binding protein 651 652 experimental:629
Rv0172 mce1D Mce family protein Mce1D 645 645 ctx cooccurence:431
Rv1906c hyp hypothetical protein 869 639 ctx cooccurence:482 textmining:652
Rv0169 mce1A Mce family protein Mce1A 621 622
Rv1796 mycP5 membrane-anchored mycosin MycP 615 615 ctx cooccurence:543

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: anti-sigma factor antagonist
  • Pfam (hmmscan --cut_ga): STAS PF01740.27 (E=9e-22), STAS_2 PF13466.13 (E=2e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216420.1)
  • Domains: Pfam-A via hmmscan --cut_ga — STAS (PF01740.27), STAS_2 (PF13466.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1366
  • Curated reference: UniProt O07728 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 104 functional partner(s); context anchor Rv0497
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002019|Rv1904|
MRTVAIGPGAGPSSTRPSSQPSDLHSGLRAVTECTGSAVVVHVGGDIDASNEVAWQRLVSKSAAIAIAPGPFVIDIRDLDFMGSCAYAVLAQESVRCRRRGVNMRLVSNQPIVARTIAACGLRRLIPLYATVETALAPPPSAH