rsfB Family assigned · medium auto-curated

H37Rv Rv3687c · MTBC0 mtbc0_003908 · 122 aa · 4153271–4153639 (-) · RefSeq NP_218204.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)anti-anti-sigma factor RsfB
MTBC0 PGAP re-annotationSTAS domain-containing protein
Revised (this work)STAS domain-containing protein. Pfam: STAS (PF01740.27), STAS_2 (PF13466.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGE1 SwissProt · reviewed · Evidence at protein level
UniProt nameAnti-sigma-F factor antagonist RsfB
Curated functionPositive regulator of sigma-F (SigF) activity. Binds to anti-sigma-F factor RsbW (UsfX) preventing its binding to SigF, thus activating transcription.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
Preferred namersfB
eggNOG descriptionBelongs to the anti-sigma-factor antagonist family
Orthologous groupCOG1366
Gene Ontology (39) GO:0000988, GO:0000989, GO:0003674, GO:0006355, GO:0008150, GO:0009889, GO:0009891, GO:0009893, GO:0010468, GO:0010556, GO:0010557, GO:0010604 +27 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 9.96% of strains (14468) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
STASPF01740.27 6.5e-1911–111 STAS domain
STAS_2PF13466.13 2.8e-1113–100 Mlab, STAS domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1364c (sigma factor regulatory protein), high confidence from genomic context alone (score 996 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1364c sigma factor regulatory protein 996 996 ctx cooccurence:569 coexpression:929 experimental:859
Rv3287c rsbW anti-sigma factor RsbW 952 857 coexpression:506 experimental:658 textmining:684
Rv1354c hyp hypothetical protein 712 694 coexpression:651
Rv1173 fbiC FO synthase 659 660 coexpression:649
Rv0655 mkl ABC transporter ATP-binding protein 644 644 experimental:629
Rv0258c hyp hypothetical protein 623 623 ctx cooccurence:623
Rv1365c rsfA anti-sigma-F factor antagonist RsfA 920 613 ctx cooccurence:611 textmining:803
Rv3351c hyp hypothetical protein 564 565 ctx cooccurence:562
Rv0247c succinate dehydrogenase iron-sulfur subunit 500 501 ctx cooccurence:496
Rv1904 hyp hypothetical protein 805 496 ctx cooccurence:493 textmining:630
Rv3503c fdxD ferredoxin FdxD 489 490 ctx cooccurence:487
Rv3688c hyp hypothetical protein 480 480 ctx neighborhood:474
Rv1265 hyp hypothetical protein 479 479 ctx cooccurence:476
Rv0249c succinate dehydrogenase membrane anchor subunit 478 478 ctx cooccurence:476
Rv1868 hyp hypothetical protein 474 474 ctx cooccurence:474

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: anti-anti-sigma factor RsfB
  • MTBC0 PGAP product: STAS domain-containing protein
  • Pfam (hmmscan --cut_ga): STAS PF01740.27 (E=7e-19), STAS_2 PF13466.13 (E=3e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218204.1)
  • Domains: Pfam-A via hmmscan --cut_ga — STAS (PF01740.27), STAS_2 (PF13466.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1366
  • Curated reference: UniProt P9WGE1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 43 functional partner(s); context anchor Rv1364c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003908|Rv3687c|rsfB
MSAPDSITVTVADHNGVAVLSIGGEIDLITAAALEEAIGEVVADNPTALVIDLSAVEFLGSVGLKILAATSEKIGQSVKFGVVARGSVTRRPIHLMGLDKTFRLFSTLHDALTGVRGGRIDR