rsfA Resolved · high auto-curated

H37Rv Rv1365c · MTBC0 mtbc0_001467 · 128 aa · 1548485–1548871 (-) · RefSeq NP_215881.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)anti-sigma-F factor antagonist RsfA
MTBC0 PGAP re-annotationanti-sigma-F factor antagonist RsfA
Revised (this work)Anti-sigma-F factor antagonist RsfA. Pfam: STAS (PF01740.27), STAS_2 (PF13466.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGE3 SwissProt · reviewed · Evidence at protein level
UniProt nameAnti-sigma-F factor antagonist RsfA
Curated functionPositive, redox-sensitive regulator of sigma-F (SigF) activity. When reduced binds to anti-sigma-F factor RsbW (UsfX) preventing its binding to SigF, thus activating transcription.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namersfA
eggNOG descriptionSTAS domain
Orthologous groupCOG1366
Gene Ontology (39) GO:0000988, GO:0000989, GO:0003674, GO:0006355, GO:0008150, GO:0009889, GO:0009891, GO:0009893, GO:0010468, GO:0010556, GO:0010557, GO:0010604 +27 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.045 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
STASPF01740.27 7.4e-2420–124 STAS domain
STAS_2PF13466.13 2.3e-1020–115 Mlab, STAS domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1364c (sigma factor regulatory protein), high confidence from genomic context alone (score 998 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1364c sigma factor regulatory protein 998 998 ctx neighborhood:545 coexpression:928 experimental:912
Rv3287c rsbW anti-sigma factor RsbW 952 901 ctx cooccurence:441 coexpression:507 experimental:658 textmining:538
Rv1354c hyp hypothetical protein 750 735 coexpression:648
Rv1173 fbiC FO synthase 658 659 coexpression:648
Rv0655 mkl ABC transporter ATP-binding protein 644 645 experimental:629
Rv3899c hyp hypothetical protein 632 633 ctx cooccurence:561
Rv3687c rsfB anti-anti-sigma factor RsfB 920 613 ctx cooccurence:611 textmining:803
Rv1752 hyp hypothetical protein 611 612 ctx cooccurence:607
Rv2079 hyp hypothetical protein 590 591 ctx cooccurence:587
Rv3912 rsmA anti-sigma-M factor RsmA 560 561 ctx cooccurence:547
Rv1366 hyp hypothetical protein 829 559 ctx neighborhood:496 textmining:630
Rv0497 transmembrane protein 556 557 ctx cooccurence:554
Rv2721c hyp hypothetical protein 552 552 ctx cooccurence:551
Rv0020c fhaA FHA domain-containing protein FhaA 542 542
Rv0172 mce1D Mce family protein Mce1D 536 536

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: anti-sigma-F factor antagonist RsfA
  • MTBC0 PGAP product: anti-sigma-F factor antagonist RsfA
  • Pfam (hmmscan --cut_ga): STAS PF01740.27 (E=7e-24), STAS_2 PF13466.13 (E=2e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215881.1)
  • Domains: Pfam-A via hmmscan --cut_ga — STAS (PF01740.27), STAS_2 (PF13466.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1366
  • Curated reference: UniProt P9WGE3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 92 functional partner(s); context anchor Rv1364c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001467|Rv1365c|rsfA
MNPTQAGSFTTPVSNALKATIQHHDSAVIIHARGEIDAANEHTWQDLVTKAAAATTAPEPLVVNLNGLDFMGCCAVAVLAHEAERCRRRGVDVRLVSRDRAVARIIHACGYGDVLPVHPTTESALSAT