oprA Resolved · high auto-curated

H37Rv Rv0516c · MTBC0 mtbc0_000544 · 158 aa · 611516–611992 (-) · RefSeq NP_215030.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)anti-anti-sigma factor
MTBC0 PGAP re-annotationosmosensory protein OprA
Revised (this work)Osmosensory protein OprA. Pfam: STAS (PF01740.27), STAS_2 (PF13466.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O33361 SwissProt · reviewed · Evidence at protein level
UniProt nameOsmosensory protein A
Curated functionPart of a signaling pathway that enables adaptation to osmotic stress through cell wall remodeling and virulence factor production. Unphosphorylated OprA forms a complex with the anti-anti-sigma-factor paralog Rv2638 that dissociates on OprA phosphorylation by PknD. Phosphorylation of OprA may stimulate the release of SigF from an inhibitory complex and enable the transcription of osmotically regulated genes, such as oprA and the ESX-1-associated virulence factor espA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
eggNOG descriptionBelongs to the anti-sigma-factor antagonist family
Orthologous groupCOG1366

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.665 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
STASPF01740.27 5.3e-1731–135 STAS domain
STAS_2PF13466.13 8.5e-0938–112 Mlab, STAS domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0517 (acyltransferase), medium confidence from genomic context alone (score 526 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1364c sigma factor regulatory protein 992 991 coexpression:928 experimental:859
Rv3287c rsbW anti-sigma factor RsbW 844 728 coexpression:506 experimental:454 textmining:452
Rv0263c hyp hypothetical protein 716 716 coexpression:716
Rv0264c hyp hypothetical protein 716 716 coexpression:716
Rv1354c hyp hypothetical protein 709 690 coexpression:647
Rv1173 fbiC FO synthase 658 658 coexpression:647
Rv0655 mkl ABC transporter ATP-binding protein 644 645 experimental:629
Rv3286c sigF RNA polymerase sigma factor SigF 891 592 textmining:745
Rv0517 acyltransferase 526 526 ctx neighborhood:494
Rv1876 bfrA bacterioferritin BfrA 501 470 coexpression:470
Rv1234 transmembrane protein 476 456 coexpression:456
Rv0167 yrbE1A membrane protein 431 431 experimental:408
Rv0168 yrbE1B membrane protein 434 429 experimental:408
Rv3500c yrbE4B integral membrane protein 431 426 experimental:408
Rv3501c yrbE4A integral membrane protein 425 426 experimental:408

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: anti-anti-sigma factor
  • MTBC0 PGAP product: osmosensory protein OprA
  • Pfam (hmmscan --cut_ga): STAS PF01740.27 (E=5e-17), STAS_2 PF13466.13 (E=9e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215030.1)
  • Domains: Pfam-A via hmmscan --cut_ga — STAS (PF01740.27), STAS_2 (PF13466.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1366
  • Curated reference: UniProt O33361 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 32 functional partner(s); context anchor Rv0517
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000544|Rv0516c|oprA
MTTTIPTSKSACSVTTRPGNAAVDYGGAQIRAYLHHLATVVTIRGEIDAANVEQISEHVRRFSLGTNPMVLDLSELSHFSGAGISLLCILDEDCRAAGVQWALVASPAVVEQLGGRCDQGEHESMFPMARSVHKALHDLADAIDRRRQLVLPLISRSA