yajC Family assigned · medium auto-curated

H37Rv Rv2588c · MTBC0 mtbc0_002755 · 115 aa · 2939390–2939737 (-) · RefSeq NP_217104.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein secretion factor YajC
MTBC0 PGAP re-annotationpreprotein translocase subunit YajC
Revised (this work)Preprotein translocase subunit YajC. Pfam: YajC (PF02699.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WL75 SwissProt · reviewed · Evidence at protein level
UniProt nameSec translocon accessory complex subunit YajC
Curated functionThe SecYEG-SecDF-YajC-YidC holo-translocon (HTL) protein secretase/insertase is a supercomplex required for protein secretion, insertion of proteins into membranes, and assembly of membrane protein complexes. While the SecYEG complex is essential for assembly of a number of proteins and complexes, the SecDF-YajC-YidC subcomplex facilitates these functions.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category U Intracellular trafficking, secretion and vesicular transport
Preferred nameyajC
eggNOG descriptionPreprotein translocase
Orthologous groupCOG1862
KEGG orthology K03210
KEGG pathways map02024, map03060, map03070
KEGG modules M00335
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.305 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
YajCPF02699.21 2.0e-186–81 Preprotein translocase subunit

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: secD (protein translocase subunit SecD), high confidence from genomic context alone (score 918 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0638 secE1 preprotein translocase SecE 984 940 coexpression:426 database:900 textmining:745
Rv0732 secY preprotein translocase SecY 971 931 database:900 textmining:601
Rv1440 secG protein-export membrane protein SecG 979 922 database:900 textmining:745
Rv2587c secD protein translocase subunit SecD 990 918 ctx neighborhood:768 coexpression:659 textmining:887
Rv3921c yidC membrane protein insertase YidC 939 918 database:900
Rv1821 secA2 accessory Sec system translocase SecA2 977 916 database:900 textmining:740
Rv2916c ffh signal recognition particle protein 983 904 database:900 textmining:838
Rv3240c secA1 protein translocase subunit SecA 991 903 database:900 textmining:921
Rv2921c ftsY signal recognition particle receptor FtsY 984 903 database:900 textmining:848
Rv2586c secF protein translocase subunit SecF 935 863 ctx neighborhood:768 coexpression:432 textmining:553
Rv2585c lipoprotein 800 800 ctx neighborhood:768
Rv2589 gabT 4-aminobutyrate aminotransferase 965 769 ctx neighborhood:768 textmining:858
Rv2584c apt adenine phosphoribosyltransferase 740 733 ctx neighborhood:699
Rv2583c relA bifunctional (p)ppGpp synthase/hydrolase RelA 733 733 ctx neighborhood:682
Rv1307 atpH ATP synthase subunit b/delta 710 710 coexpression:661

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein secretion factor YajC
  • MTBC0 PGAP product: preprotein translocase subunit YajC
  • Pfam (hmmscan --cut_ga): YajC PF02699.21 (E=2e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217104.1)
  • Domains: Pfam-A via hmmscan --cut_ga — YajC (PF02699.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1862
  • Curated reference: UniProt P9WL75 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 85 functional partner(s); context anchor secD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002755|Rv2588c|yajC
MESFVLFLPFLLIMGGFMYFASRRQRRAMQATIDLHDSLQPGERVHTTSGLEATIVAIADDTIDLEIAPGVVTTWMKLAIRDRILPDDDIDEELNEDLDKDVDDVAGERRVTNDS