moaE1 Family assigned · medium auto-curated

H37Rv Rv3119 · MTBC0 - · 147 aa · 3485132–3485575 (+) · RefSeq YP_177931.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)molybdopterin synthase catalytic subunit 1
MTBC0 PGAP re-annotation
Revised (this work)Molybdopterin synthase catalytic subunit 1. Pfam: MoaE (PF02391.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WJR3 SwissProt · reviewed · Evidence at protein level
UniProt nameMolybdopterin synthase catalytic subunit 1
EC (curated) EC 2.8.1.12
Curated functionConverts molybdopterin precursor Z into molybdopterin. This requires the incorporation of two sulfur atoms into precursor Z to generate a dithiolene group. The sulfur is provided by MoaD (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namemoaE
eggNOG descriptionMolybdopterin
Orthologous groupCOG0314
EC number EC 2.8.1.12
KEGG orthology K03635, K21142
KEGG pathways map00790, map01100, map04122
Gene Ontology (71) GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006139, GO:0006163, GO:0006725, GO:0006732, GO:0006753 +59 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.905 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MoaEPF02391.23 3.6e-3615–127 MoaE protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: moaC1 (cyclic pyranopterin monophosphate synthase accessory protein), high confidence from genomic context alone (score 982 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0868c moaD2 cyclic pyranopterin monophosphate synthase 997 993 coexpression:491 experimental:868 database:900 textmining:597
Rv3111 moaC1 cyclic pyranopterin monophosphate synthase accessory protein 996 982 ctx cooccurence:476 coexpression:560 database:900 textmining:825
Rv3112 moaD1 molybdenum cofactor biosynthesis protein MoaD 997 981 coexpression:493 experimental:463 database:900 textmining:888
Rv3324c moaC3 cyclic pyranopterin monophosphate synthase accessory protein 989 978 ctx cooccurence:483 coexpression:558 database:900 textmining:566
Rv0864 moaC2 cyclic pyranopterin monophosphate synthase accessory protein 980 978 ctx cooccurence:497 coexpression:560 database:900
Rv1335 cysO sulfur carrier protein CysO 981 972 coexpression:500 experimental:463 database:900
Rv3323c moaX MoaD-MoaE fusion protein MoaX 973 972 coexpression:491 experimental:463 database:900
Rv3120 hyp hypothetical protein 958 958 ctx neighborhood:801 coexpression:798
Rv3116 moeB2 molybdenum cofactor biosynthesis protein MoeB 987 952 ctx neighborhood:657 coexpression:460 database:668 textmining:754
Rv3109 moaA1 cyclic pyranopterin monophosphate synthase 970 913 ctx cooccurence:667 coexpression:402 database:500 textmining:671
Rv0866 moaE2 molybdopterin synthase catalytic subunit 2 913 913 database:900
Rv0869c moaA2 molybdenum cofactor biosynthesis protein MoaA 870 862 ctx cooccurence:559 coexpression:402 database:500
Rv0865 mog molybdopterin biosynthesis protein 822 768 coexpression:412 database:500
Rv3206c moeB1 adenylyltransferase/sulfurtransferase MoeZ 866 747 coexpression:440 textmining:494
Rv0438c moeA2 molybdopterin molybdenumtransferase 771 747 ctx cooccurence:539 coexpression:453

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): molybdopterin synthase catalytic subunit 1
  • Pfam (hmmscan --cut_ga): MoaE PF02391.23 (E=4e-36)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177931.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MoaE (PF02391.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0314
  • Curated reference: UniProt P9WJR3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 42 functional partner(s); context anchor moaC1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3119|moaE1
MANVVAEGAYPYCRLTDQPLSVDEVLAAVSGPEQGGIVIFVGNVRDHNAGHDVTRLFYEAYPPMVIRTLMSIIGRCEDKAEGVRVAVAHRTGELQIGDAAVVIGASAPHRAEAFDAARMCIELLKQEVPIWKKEFSSTGAEWVGDRP