moaC3 Resolved · high auto-curated
H37Rv Rv3324c · MTBC0 mtbc0_003534 ·
177 aa · 3731853–3732386 (-) ·
RefSeq NP_217841.3
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | cyclic pyranopterin monophosphate synthase accessory protein |
|---|---|
| MTBC0 PGAP re-annotation | cyclic pyranopterin monophosphate synthase MoaC |
| Revised (this work) | Cyclic pyranopterin monophosphate synthase MoaC. Pfam: MoaC (PF01967.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WJR5
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Cyclic pyranopterin monophosphate synthase 3 |
| EC (curated) |
EC 4.6.1.17
|
| Curated function | Catalyzes the conversion of (8S)-3',8-cyclo-7,8-dihydroguanosine 5'-triphosphate to cyclic pyranopterin monophosphate (cPMP). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | moaC |
| eggNOG description | Catalyzes the conversion of (8S)-3',8-cyclo-7,8- dihydroguanosine 5'-triphosphate to cyclic pyranopterin monophosphate (cPMP) |
| Orthologous group | COG0315 |
| EC number |
EC 4.6.1.17
|
| KEGG orthology |
K03637
|
| KEGG pathways |
map00790, map01100, map04122
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.353 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 0.26% of strains (374) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MoaC | PF01967.28 | 9.5e-55 | 19–153 | MoaC family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: moaA2 (molybdenum cofactor biosynthesis protein MoaA), high confidence from genomic context alone (score 999 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0869c moaA2 |
molybdenum cofactor biosynthesis protein MoaA | 999 | 999 ctx | fusion:899 cooccurence:773 coexpression:645 database:900 textmining:483 |
Rv3323c moaX |
MoaD-MoaE fusion protein MoaX | 999 | 999 ctx | neighborhood:801 cooccurence:471 coexpression:921 database:900 textmining:845 |
Rv3109 moaA1 |
cyclic pyranopterin monophosphate synthase | 999 | 996 ctx | fusion:579 cooccurence:772 coexpression:649 database:900 textmining:901 |
Rv0865 mog |
molybdopterin biosynthesis protein | 984 | 981 ctx | fusion:883 cooccurence:712 coexpression:439 |
Rv3119 moaE1 |
molybdopterin synthase catalytic subunit 1 | 989 | 978 ctx | cooccurence:483 coexpression:558 database:900 textmining:566 |
Rv0866 moaE2 |
molybdopterin synthase catalytic subunit 2 | 987 | 976 ctx | cooccurence:425 coexpression:559 database:900 textmining:524 |
Rv0864 moaC2 |
cyclic pyranopterin monophosphate synthase accessory protein | 915 | 908 | database:900 |
Rv3111 moaC1 |
cyclic pyranopterin monophosphate synthase accessory protein | 905 | 903 | database:900 |
Rv3324A |
Rv3324A, len: 44 aa. Probable pseudogene moaB3,fragment of pterin-4-alpha-carbinolamine dehydratase,equivalent to C-terminus of MT3426|Q8VJ3 | 945 | 888 ctx | neighborhood:882 textmining:533 |
Rv0984 moaB2 |
pterin-4-alpha-carbinolamine dehydratase | 902 | 877 ctx | cooccurence:726 coexpression:437 |
Rv0438c moeA2 |
molybdopterin molybdenumtransferase | 883 | 867 ctx | cooccurence:763 coexpression:430 |
Rv0994 moeA1 |
molybdopterin molybdenumtransferase 1 | 871 | 854 ctx | cooccurence:738 coexpression:434 |
Rv3322c |
methyltransferase | 808 | 807 ctx | neighborhood:801 |
Rv0868c moaD2 |
cyclic pyranopterin monophosphate synthase | 912 | 761 | coexpression:507 database:500 textmining:649 |
Rv3326 |
Probable transposase; Rv3326, (MTV016.26), len: 328 aa. Probable transposase for insertion element IS6110. Identical to many other M. tuberc | 560 | 559 ctx | neighborhood:559 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: cyclic pyranopterin monophosphate synthase accessory protein
- MTBC0 PGAP product: cyclic pyranopterin monophosphate synthase MoaC
- Pfam (hmmscan --cut_ga): MoaC PF01967.28 (E=1e-54)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217841.3)
- Domains: Pfam-A via hmmscan --cut_ga — MoaC (PF01967.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0315 - Curated reference: UniProt P9WJR5 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
28 functional partner(s); context anchor
moaA2 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003534|Rv3324c|moaC3 MNDHDGVLTHLDEQGAARMVDVSAKAVTLRRARASGAVLMKPSTLDMICHGTAAKGDVIATARIAGIMAAKRTGELIPLCHPLGIEAVTVTLEPQGADRLSIAATVTTVARTGVEMEALTAVTVTALTVYDMCKAVDRAMTITDIRLDEKSGGRSGHYRRHDADVKPSDGGSTEDGC