moaC3 Resolved · high auto-curated

H37Rv Rv3324c · MTBC0 mtbc0_003534 · 177 aa · 3731853–3732386 (-) · RefSeq NP_217841.3

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cyclic pyranopterin monophosphate synthase accessory protein
MTBC0 PGAP re-annotationcyclic pyranopterin monophosphate synthase MoaC
Revised (this work)Cyclic pyranopterin monophosphate synthase MoaC. Pfam: MoaC (PF01967.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJR5 SwissProt · reviewed · Inferred from homology
UniProt nameCyclic pyranopterin monophosphate synthase 3
EC (curated) EC 4.6.1.17
Curated functionCatalyzes the conversion of (8S)-3',8-cyclo-7,8-dihydroguanosine 5'-triphosphate to cyclic pyranopterin monophosphate (cPMP).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namemoaC
eggNOG descriptionCatalyzes the conversion of (8S)-3',8-cyclo-7,8- dihydroguanosine 5'-triphosphate to cyclic pyranopterin monophosphate (cPMP)
Orthologous groupCOG0315
EC number EC 4.6.1.17
KEGG orthology K03637
KEGG pathways map00790, map01100, map04122

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.353 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.26% of strains (374) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MoaCPF01967.28 9.5e-5519–153 MoaC family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: moaA2 (molybdenum cofactor biosynthesis protein MoaA), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0869c moaA2 molybdenum cofactor biosynthesis protein MoaA 999 999 ctx fusion:899 cooccurence:773 coexpression:645 database:900 textmining:483
Rv3323c moaX MoaD-MoaE fusion protein MoaX 999 999 ctx neighborhood:801 cooccurence:471 coexpression:921 database:900 textmining:845
Rv3109 moaA1 cyclic pyranopterin monophosphate synthase 999 996 ctx fusion:579 cooccurence:772 coexpression:649 database:900 textmining:901
Rv0865 mog molybdopterin biosynthesis protein 984 981 ctx fusion:883 cooccurence:712 coexpression:439
Rv3119 moaE1 molybdopterin synthase catalytic subunit 1 989 978 ctx cooccurence:483 coexpression:558 database:900 textmining:566
Rv0866 moaE2 molybdopterin synthase catalytic subunit 2 987 976 ctx cooccurence:425 coexpression:559 database:900 textmining:524
Rv0864 moaC2 cyclic pyranopterin monophosphate synthase accessory protein 915 908 database:900
Rv3111 moaC1 cyclic pyranopterin monophosphate synthase accessory protein 905 903 database:900
Rv3324A Rv3324A, len: 44 aa. Probable pseudogene moaB3,fragment of pterin-4-alpha-carbinolamine dehydratase,equivalent to C-terminus of MT3426|Q8VJ3 945 888 ctx neighborhood:882 textmining:533
Rv0984 moaB2 pterin-4-alpha-carbinolamine dehydratase 902 877 ctx cooccurence:726 coexpression:437
Rv0438c moeA2 molybdopterin molybdenumtransferase 883 867 ctx cooccurence:763 coexpression:430
Rv0994 moeA1 molybdopterin molybdenumtransferase 1 871 854 ctx cooccurence:738 coexpression:434
Rv3322c methyltransferase 808 807 ctx neighborhood:801
Rv0868c moaD2 cyclic pyranopterin monophosphate synthase 912 761 coexpression:507 database:500 textmining:649
Rv3326 Probable transposase; Rv3326, (MTV016.26), len: 328 aa. Probable transposase for insertion element IS6110. Identical to many other M. tuberc 560 559 ctx neighborhood:559

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: cyclic pyranopterin monophosphate synthase accessory protein
  • MTBC0 PGAP product: cyclic pyranopterin monophosphate synthase MoaC
  • Pfam (hmmscan --cut_ga): MoaC PF01967.28 (E=1e-54)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217841.3)
  • Domains: Pfam-A via hmmscan --cut_ga — MoaC (PF01967.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0315
  • Curated reference: UniProt P9WJR5 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 28 functional partner(s); context anchor moaA2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003534|Rv3324c|moaC3
MNDHDGVLTHLDEQGAARMVDVSAKAVTLRRARASGAVLMKPSTLDMICHGTAAKGDVIATARIAGIMAAKRTGELIPLCHPLGIEAVTVTLEPQGADRLSIAATVTTVARTGVEMEALTAVTVTALTVYDMCKAVDRAMTITDIRLDEKSGGRSGHYRRHDADVKPSDGGSTEDGC