moaE2 Family assigned · medium auto-curated

H37Rv Rv0866 · MTBC0 mtbc0_000921 · 141 aa · 967072–967497 (+) · RefSeq NP_215381.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)molybdopterin synthase catalytic subunit 2
MTBC0 PGAP re-annotationmolybdopterin synthase subunit MoaE2
Revised (this work)Molybdopterin synthase subunit MoaE2. Pfam: MoaE (PF02391.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJR1 SwissProt · reviewed · Evidence at protein level
UniProt nameMolybdopterin synthase catalytic subunit 2
EC (curated) EC 2.8.1.12
Curated functionConverts molybdopterin precursor Z into molybdopterin. This requires the incorporation of two sulfur atoms into precursor Z to generate a dithiolene group. The sulfur is provided by MoaD (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namemoaE
eggNOG descriptionMolybdopterin converting factor, large subunit
Orthologous groupCOG0314
EC number EC 2.8.1.12
KEGG orthology K03635
KEGG pathways map00790, map01100, map04122
Gene Ontology (71) GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006139, GO:0006163, GO:0006725, GO:0006732, GO:0006753 +59 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.089 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.21% of strains (305) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MoaEPF02391.23 1.2e-309–121 MoaE protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mog (molybdopterin biosynthesis protein), high confidence from genomic context alone (score 997 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0868c moaD2 cyclic pyranopterin monophosphate synthase 999 1000 coexpression:494 experimental:999 database:900 textmining:663
Rv0865 mog molybdopterin biosynthesis protein 999 997 ctx neighborhood:882 fusion:900 coexpression:466 database:500 textmining:926
Rv0864 moaC2 cyclic pyranopterin monophosphate synthase accessory protein 998 997 ctx neighborhood:882 cooccurence:474 coexpression:570 database:900 textmining:654
Rv3111 moaC1 cyclic pyranopterin monophosphate synthase accessory protein 994 978 ctx cooccurence:408 coexpression:558 database:900 textmining:768
Rv3324c moaC3 cyclic pyranopterin monophosphate synthase accessory protein 987 976 ctx cooccurence:425 coexpression:559 database:900 textmining:524
Rv3112 moaD1 molybdenum cofactor biosynthesis protein MoaD 976 975 coexpression:491 experimental:463 database:900
Rv3323c moaX MoaD-MoaE fusion protein MoaX 976 975 coexpression:492 experimental:463 database:900
Rv1335 cysO sulfur carrier protein CysO 978 971 coexpression:494 experimental:463 database:900
Rv3116 moeB2 molybdenum cofactor biosynthesis protein MoeB 984 930 coexpression:432 database:668 textmining:790
Rv3119 moaE1 molybdopterin synthase catalytic subunit 1 913 913 database:900
Rv3109 moaA1 cyclic pyranopterin monophosphate synthase 991 910 ctx cooccurence:688 coexpression:402 database:500 textmining:909
Rv0869c moaA2 molybdenum cofactor biosynthesis protein MoaA 995 907 ctx cooccurence:641 coexpression:408 database:500 textmining:949
Rv0863 hyp hypothetical protein 877 877 ctx neighborhood:876
Rv3206c moeB1 adenylyltransferase/sulfurtransferase MoeZ 910 852 coexpression:434 textmining:422
Rv0438c moeA2 molybdopterin molybdenumtransferase 906 818 ctx cooccurence:604 coexpression:451 textmining:508

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: molybdopterin synthase catalytic subunit 2
  • MTBC0 PGAP product: molybdopterin synthase subunit MoaE2
  • Pfam (hmmscan --cut_ga): MoaE PF02391.23 (E=1e-30)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215381.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MoaE (PF02391.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0314
  • Curated reference: UniProt P9WJR1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 41 functional partner(s); context anchor mog
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000921|Rv0866|moaE2
MTQVLRAALTDQPIFLAEHEELVSHRSAGAIVGFVGMIRDRDGGRGVLRLEYSAHPSAAQVLADLVAEVAEESSGVRAVAASHRIGVLQVGEAALVAAVAADHRRAAFGTCAHLVETIKARLPVWKHQFFEDGTDEWVGSV