moaE2 Family assigned · medium auto-curated
H37Rv Rv0866 · MTBC0 mtbc0_000921 ·
141 aa · 967072–967497 (+) ·
RefSeq NP_215381.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | molybdopterin synthase catalytic subunit 2 |
|---|---|
| MTBC0 PGAP re-annotation | molybdopterin synthase subunit MoaE2 |
| Revised (this work) | Molybdopterin synthase subunit MoaE2. Pfam: MoaE (PF02391.23). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WJR1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Molybdopterin synthase catalytic subunit 2 |
| EC (curated) |
EC 2.8.1.12
|
| Curated function | Converts molybdopterin precursor Z into molybdopterin. This requires the incorporation of two sulfur atoms into precursor Z to generate a dithiolene group. The sulfur is provided by MoaD (By similarity). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | moaE |
| eggNOG description | Molybdopterin converting factor, large subunit |
| Orthologous group | COG0314 |
| EC number |
EC 2.8.1.12
|
| KEGG orthology |
K03635
|
| KEGG pathways |
map00790, map01100, map04122
|
| Gene Ontology (71) |
GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006139, GO:0006163, GO:0006725, GO:0006732, GO:0006753 +59 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.089 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 1 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.21% of strains (305) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MoaE | PF02391.23 | 1.2e-30 | 9–121 | MoaE protein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mog (molybdopterin biosynthesis protein), high confidence from genomic context alone (score 997 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0868c moaD2 |
cyclic pyranopterin monophosphate synthase | 999 | 1000 | coexpression:494 experimental:999 database:900 textmining:663 |
Rv0865 mog |
molybdopterin biosynthesis protein | 999 | 997 ctx | neighborhood:882 fusion:900 coexpression:466 database:500 textmining:926 |
Rv0864 moaC2 |
cyclic pyranopterin monophosphate synthase accessory protein | 998 | 997 ctx | neighborhood:882 cooccurence:474 coexpression:570 database:900 textmining:654 |
Rv3111 moaC1 |
cyclic pyranopterin monophosphate synthase accessory protein | 994 | 978 ctx | cooccurence:408 coexpression:558 database:900 textmining:768 |
Rv3324c moaC3 |
cyclic pyranopterin monophosphate synthase accessory protein | 987 | 976 ctx | cooccurence:425 coexpression:559 database:900 textmining:524 |
Rv3112 moaD1 |
molybdenum cofactor biosynthesis protein MoaD | 976 | 975 | coexpression:491 experimental:463 database:900 |
Rv3323c moaX |
MoaD-MoaE fusion protein MoaX | 976 | 975 | coexpression:492 experimental:463 database:900 |
Rv1335 cysO |
sulfur carrier protein CysO | 978 | 971 | coexpression:494 experimental:463 database:900 |
Rv3116 moeB2 |
molybdenum cofactor biosynthesis protein MoeB | 984 | 930 | coexpression:432 database:668 textmining:790 |
Rv3119 moaE1 |
molybdopterin synthase catalytic subunit 1 | 913 | 913 | database:900 |
Rv3109 moaA1 |
cyclic pyranopterin monophosphate synthase | 991 | 910 ctx | cooccurence:688 coexpression:402 database:500 textmining:909 |
Rv0869c moaA2 |
molybdenum cofactor biosynthesis protein MoaA | 995 | 907 ctx | cooccurence:641 coexpression:408 database:500 textmining:949 |
Rv0863 hyp |
hypothetical protein | 877 | 877 ctx | neighborhood:876 |
Rv3206c moeB1 |
adenylyltransferase/sulfurtransferase MoeZ | 910 | 852 | coexpression:434 textmining:422 |
Rv0438c moeA2 |
molybdopterin molybdenumtransferase | 906 | 818 ctx | cooccurence:604 coexpression:451 textmining:508 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: molybdopterin synthase catalytic subunit 2
- MTBC0 PGAP product: molybdopterin synthase subunit MoaE2
- Pfam (hmmscan --cut_ga): MoaE PF02391.23 (E=1e-30)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215381.1)
- Domains: Pfam-A via hmmscan --cut_ga — MoaE (PF02391.23)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0314 - Curated reference: UniProt P9WJR1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
41 functional partner(s); context anchor
mog - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000921|Rv0866|moaE2 MTQVLRAALTDQPIFLAEHEELVSHRSAGAIVGFVGMIRDRDGGRGVLRLEYSAHPSAAQVLADLVAEVAEESSGVRAVAASHRIGVLQVGEAALVAAVAADHRRAAFGTCAHLVETIKARLPVWKHQFFEDGTDEWVGSV