cysA3 Resolved · high auto-curated
H37Rv Rv3117 · MTBC0 - ·
277 aa · 3483974–3484807 (+) ·
RefSeq NP_217633.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | thiosulfate sulfurtransferase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Thiosulfate sulfurtransferase. Pfam: Rhodanese (PF00581.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WHF9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative thiosulfate sulfurtransferase |
| EC (curated) |
EC 2.8.1.1
|
| Curated function | May be a sulfotransferase involved in the formation of thiosulfate. |
UniProt still lists this protein as Putative thiosulfate sulfurtransferase; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | cysA3 |
| eggNOG description | sulfurtransferase |
| Orthologous group | COG2897 |
| EC number |
EC 2.8.1.1, EC 2.8.1.2
|
| KEGG orthology |
K01011
|
| KEGG pathways |
map00270, map00920, map01100, map01120, map04122
|
| Gene Ontology (13) |
GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0016020, GO:0030312, GO:0044424, GO:0044444, GO:0044464 +1 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Rhodanese | PF00581.26 | 7.9e-19 | 149–265 | Rhodanese-like domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: moeB2 (molybdenum cofactor biosynthesis protein MoeB), high confidence from genomic context alone (score 736 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3118 sseC1 hyp |
hypothetical protein | 972 | 844 ctx | neighborhood:789 textmining:828 |
Rv0814c sseC2 hyp |
hypothetical protein | 919 | 805 | coexpression:729 textmining:602 |
Rv3116 moeB2 |
molybdenum cofactor biosynthesis protein MoeB | 767 | 736 ctx | neighborhood:701 |
Rv3119 moaE1 |
molybdopterin synthase catalytic subunit 1 | 840 | 717 ctx | neighborhood:714 textmining:458 |
Rv3120 hyp |
hypothetical protein | 716 | 716 ctx | neighborhood:714 |
Rv0816c thiX |
thioredoxin ThiX | 615 | 613 | database:561 |
Rv0331 |
dehydrogenase/reductase | 621 | 587 | database:535 |
Rv2874 dipZ |
integral membrane C-type cytochrome biogenesis protein DipZ | 599 | 578 | database:561 |
Rv3673c |
membrane-anchored thioredoxin-like protein | 579 | 577 | database:561 |
Rv1677 dsbF |
lipoprotein DsbF | 579 | 577 | database:561 |
Rv0526 |
thioredoxin | 576 | 575 | database:561 |
Rv2878c mpt53 |
soluble secreted antigen Mpt53 | 576 | 575 | database:561 |
Rv3115 |
transposase | 498 | 498 ctx | neighborhood:495 |
Rv3121 cyp141 |
cytochrome P450 Cyp141 | 590 | 373 | |
Rv2291 sseB |
thiosulfate sulfurtransferase SseB | 431 | 305 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): thiosulfate sulfurtransferase
- Pfam (hmmscan --cut_ga): Rhodanese PF00581.26 (E=8e-19)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217633.1)
- Domains: Pfam-A via hmmscan --cut_ga — Rhodanese (PF00581.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2897 - Curated reference: UniProt P9WHF9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
24 functional partner(s); context anchor
moeB2 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3117|cysA3 MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRDHIAGAIKLDWRTDLQDPVKRDFVDAQQFSKLLSERGIANEDTVILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASPPDNTIRAFRDEVLAAINVKNLIDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSRAANEDGTFKSDEELAKLYADAGLDNSKETIAYCRIGERSSHTWFVLRELLGHQNVKNYDGSWTEYGSLVGAPIELGS