cysA3 Resolved · high auto-curated

H37Rv Rv3117 · MTBC0 - · 277 aa · 3483974–3484807 (+) · RefSeq NP_217633.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)thiosulfate sulfurtransferase
MTBC0 PGAP re-annotation
Revised (this work)Thiosulfate sulfurtransferase. Pfam: Rhodanese (PF00581.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WHF9 SwissProt · reviewed · Evidence at protein level
UniProt namePutative thiosulfate sulfurtransferase
EC (curated) EC 2.8.1.1
Curated functionMay be a sulfotransferase involved in the formation of thiosulfate.

UniProt still lists this protein as Putative thiosulfate sulfurtransferase; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namecysA3
eggNOG descriptionsulfurtransferase
Orthologous groupCOG2897
EC number EC 2.8.1.1, EC 2.8.1.2
KEGG orthology K01011
KEGG pathways map00270, map00920, map01100, map01120, map04122
Gene Ontology (13) GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0016020, GO:0030312, GO:0044424, GO:0044444, GO:0044464 +1 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RhodanesePF00581.26 7.9e-19149–265 Rhodanese-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: moeB2 (molybdenum cofactor biosynthesis protein MoeB), high confidence from genomic context alone (score 736 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3118 sseC1 hyp hypothetical protein 972 844 ctx neighborhood:789 textmining:828
Rv0814c sseC2 hyp hypothetical protein 919 805 coexpression:729 textmining:602
Rv3116 moeB2 molybdenum cofactor biosynthesis protein MoeB 767 736 ctx neighborhood:701
Rv3119 moaE1 molybdopterin synthase catalytic subunit 1 840 717 ctx neighborhood:714 textmining:458
Rv3120 hyp hypothetical protein 716 716 ctx neighborhood:714
Rv0816c thiX thioredoxin ThiX 615 613 database:561
Rv0331 dehydrogenase/reductase 621 587 database:535
Rv2874 dipZ integral membrane C-type cytochrome biogenesis protein DipZ 599 578 database:561
Rv3673c membrane-anchored thioredoxin-like protein 579 577 database:561
Rv1677 dsbF lipoprotein DsbF 579 577 database:561
Rv0526 thioredoxin 576 575 database:561
Rv2878c mpt53 soluble secreted antigen Mpt53 576 575 database:561
Rv3115 transposase 498 498 ctx neighborhood:495
Rv3121 cyp141 cytochrome P450 Cyp141 590 373
Rv2291 sseB thiosulfate sulfurtransferase SseB 431 305

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): thiosulfate sulfurtransferase
  • Pfam (hmmscan --cut_ga): Rhodanese PF00581.26 (E=8e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217633.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rhodanese (PF00581.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2897
  • Curated reference: UniProt P9WHF9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s); context anchor moeB2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3117|cysA3
MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRDHIAGAIKLDWRTDLQDPVKRDFVDAQQFSKLLSERGIANEDTVILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASPPDNTIRAFRDEVLAAINVKNLIDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSRAANEDGTFKSDEELAKLYADAGLDNSKETIAYCRIGERSSHTWFVLRELLGHQNVKNYDGSWTEYGSLVGAPIELGS