cysO Resolved · high auto-curated

H37Rv Rv1335 · MTBC0 mtbc0_001432 · 93 aa · 1513805–1514086 (+) · RefSeq NP_215851.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)sulfur carrier protein CysO
MTBC0 PGAP re-annotationsulfur carrier protein CysO
Revised (this work)Sulfur carrier protein CysO. Pfam: ThiS (PF02597.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WP33 SwissProt · reviewed · Evidence at protein level
UniProt nameSulfur carrier protein CysO
Curated functionIn its thiocarboxylated form (CysO-COSH), is the sulfur donor in the CysM-dependent cysteine biosynthetic pathway. May be of particular importance for cysteine biosynthesis in the persistent phase of M.tuberculosis.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namecysO
eggNOG descriptionMolybdopterin converting factor, small subunit
Orthologous groupCOG1977
KEGG orthology K03636
KEGG pathways map04122
Gene Ontology (40) GO:0000096, GO:0000097, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006082, GO:0006520, GO:0006534, GO:0006790, GO:0006807 +28 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ThiSPF02597.27 5.2e-175–93 ThiS family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cysM (O-phosphoserine sulfhydrylase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1336 cysM O-phosphoserine sulfhydrylase 999 1000 ctx neighborhood:876 coexpression:808 experimental:999 textmining:901
Rv1334 mec [CysO 991 991 ctx neighborhood:851 cooccurence:715 coexpression:797
Rv3206c moeB1 adenylyltransferase/sulfurtransferase MoeZ 997 978 ctx cooccurence:598 experimental:415 database:900 textmining:885
Rv0417 thiG thiazole synthase 976 974 experimental:973
Rv3116 moeB2 molybdenum cofactor biosynthesis protein MoeB 991 973 ctx cooccurence:531 experimental:415 database:900 textmining:697
Rv3119 moaE1 molybdopterin synthase catalytic subunit 1 981 972 coexpression:500 experimental:463 database:900
Rv3323c moaX MoaD-MoaE fusion protein MoaX 979 971 coexpression:491 experimental:463 database:900
Rv0866 moaE2 molybdopterin synthase catalytic subunit 2 978 971 coexpression:494 experimental:463 database:900
Rv3112 moaD1 molybdenum cofactor biosynthesis protein MoaD 944 921 database:900
Rv0868c moaD2 cyclic pyranopterin monophosphate synthase 949 901 database:900 textmining:511
Rv1337 integral membrane protein 896 897 ctx neighborhood:876
Rv1338 murI glutamate racemase 882 882 ctx neighborhood:876
Rv1333 hydrolase 856 856 ctx neighborhood:851
Rv2334 cysK1 O-acetylserine sulfhydrylase 946 842 experimental:828 textmining:675
Rv1077 cbs cystathionine beta-synthase 849 841 experimental:828

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: sulfur carrier protein CysO
  • MTBC0 PGAP product: sulfur carrier protein CysO
  • Pfam (hmmscan --cut_ga): ThiS PF02597.27 (E=5e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215851.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ThiS (PF02597.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1977
  • Curated reference: UniProt P9WP33 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 44 functional partner(s); context anchor cysM
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001432|Rv1335|cysO
MNVTVSIPTILRPHTGGQKSVSASGDTLGAVISDLEANYSGISERLMDPSSPGKLHRFVNIYVNDEDVRFSGGLATAIADGDSVTILPAVAGG