cysO Resolved · high auto-curated
H37Rv Rv1335 · MTBC0 mtbc0_001432 ·
93 aa · 1513805–1514086 (+) ·
RefSeq NP_215851.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | sulfur carrier protein CysO |
|---|---|
| MTBC0 PGAP re-annotation | sulfur carrier protein CysO |
| Revised (this work) | Sulfur carrier protein CysO. Pfam: ThiS (PF02597.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WP33
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Sulfur carrier protein CysO |
| Curated function | In its thiocarboxylated form (CysO-COSH), is the sulfur donor in the CysM-dependent cysteine biosynthetic pathway. May be of particular importance for cysteine biosynthesis in the persistent phase of M.tuberculosis. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | cysO |
| eggNOG description | Molybdopterin converting factor, small subunit |
| Orthologous group | COG1977 |
| KEGG orthology |
K03636
|
| KEGG pathways |
map04122
|
| Gene Ontology (40) |
GO:0000096, GO:0000097, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006082, GO:0006520, GO:0006534, GO:0006790, GO:0006807 +28 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ThiS | PF02597.27 | 5.2e-17 | 5–93 | ThiS family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: cysM (O-phosphoserine sulfhydrylase), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1336 cysM |
O-phosphoserine sulfhydrylase | 999 | 1000 ctx | neighborhood:876 coexpression:808 experimental:999 textmining:901 |
Rv1334 mec |
[CysO | 991 | 991 ctx | neighborhood:851 cooccurence:715 coexpression:797 |
Rv3206c moeB1 |
adenylyltransferase/sulfurtransferase MoeZ | 997 | 978 ctx | cooccurence:598 experimental:415 database:900 textmining:885 |
Rv0417 thiG |
thiazole synthase | 976 | 974 | experimental:973 |
Rv3116 moeB2 |
molybdenum cofactor biosynthesis protein MoeB | 991 | 973 ctx | cooccurence:531 experimental:415 database:900 textmining:697 |
Rv3119 moaE1 |
molybdopterin synthase catalytic subunit 1 | 981 | 972 | coexpression:500 experimental:463 database:900 |
Rv3323c moaX |
MoaD-MoaE fusion protein MoaX | 979 | 971 | coexpression:491 experimental:463 database:900 |
Rv0866 moaE2 |
molybdopterin synthase catalytic subunit 2 | 978 | 971 | coexpression:494 experimental:463 database:900 |
Rv3112 moaD1 |
molybdenum cofactor biosynthesis protein MoaD | 944 | 921 | database:900 |
Rv0868c moaD2 |
cyclic pyranopterin monophosphate synthase | 949 | 901 | database:900 textmining:511 |
Rv1337 |
integral membrane protein | 896 | 897 ctx | neighborhood:876 |
Rv1338 murI |
glutamate racemase | 882 | 882 ctx | neighborhood:876 |
Rv1333 |
hydrolase | 856 | 856 ctx | neighborhood:851 |
Rv2334 cysK1 |
O-acetylserine sulfhydrylase | 946 | 842 | experimental:828 textmining:675 |
Rv1077 cbs |
cystathionine beta-synthase | 849 | 841 | experimental:828 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: sulfur carrier protein CysO
- MTBC0 PGAP product: sulfur carrier protein CysO
- Pfam (hmmscan --cut_ga): ThiS PF02597.27 (E=5e-17)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215851.1)
- Domains: Pfam-A via hmmscan --cut_ga — ThiS (PF02597.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1977 - Curated reference: UniProt P9WP33 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
44 functional partner(s); context anchor
cysM - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001432|Rv1335|cysO MNVTVSIPTILRPHTGGQKSVSASGDTLGAVISDLEANYSGISERLMDPSSPGKLHRFVNIYVNDEDVRFSGGLATAIADGDSVTILPAVAGG