moeA2 Resolved · high auto-curated

H37Rv Rv0438c · MTBC0 - · 405 aa · 526143–527360 (-) · RefSeq YP_177725.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)molybdopterin molybdenumtransferase
MTBC0 PGAP re-annotation
Revised (this work)Molybdopterin molybdenumtransferase. Pfam: MoeA_N (PF03453.23), MoCF_biosynth (PF00994.30), MoeA_C (PF03454.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WJQ5 SwissProt · reviewed · Evidence at protein level
UniProt nameMolybdopterin molybdenumtransferase 2
EC (curated) EC 2.10.1.1
Curated functionCatalyzes the insertion of molybdate into adenylated molybdopterin with the concomitant release of AMP.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namemoeA
eggNOG descriptionMolybdopterin
Orthologous groupCOG0303
EC number EC 2.10.1.1
KEGG orthology K03750
KEGG pathways map00790, map01100
Gene Ontology (76) GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006139, GO:0006163, GO:0006464, GO:0006725, GO:0006732, GO:0006753 +64 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.682 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 9 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MoeA_NPF03453.23 3.1e-443–166 MoeA N-terminal region (domain I and II)
MoCF_biosynthPF00994.30 1.6e-30180–321 Probable molybdopterin binding domain
MoeA_CPF03454.21 1.3e-15336–404 MoeA C-terminal region (domain IV)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mog (molybdopterin biosynthesis protein), high confidence from genomic context alone (score 949 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2453c mobA molybdenum cofactor guanylyltransferase 957 952 database:900
Rv0865 mog molybdopterin biosynthesis protein 960 949 ctx fusion:442 cooccurence:736 database:500
Rv3323c moaX MoaD-MoaE fusion protein MoaX 943 925 ctx cooccurence:581 coexpression:805
Rv0994 moeA1 molybdopterin molybdenumtransferase 1 917 917 database:900
Rv0345 hyp hypothetical protein 903 903 database:900
Rv0371c hyp hypothetical protein 903 903 database:900
Rv3111 moaC1 cyclic pyranopterin monophosphate synthase accessory protein 919 886 ctx cooccurence:762 coexpression:430
Rv0864 moaC2 cyclic pyranopterin monophosphate synthase accessory protein 884 868 ctx cooccurence:766 coexpression:430
Rv3324c moaC3 cyclic pyranopterin monophosphate synthase accessory protein 883 867 ctx cooccurence:763 coexpression:430
Rv0869c moaA2 molybdenum cofactor biosynthesis protein MoaA 903 864 ctx cooccurence:767
Rv3109 moaA1 cyclic pyranopterin monophosphate synthase 853 835 ctx cooccurence:766
Rv0866 moaE2 molybdopterin synthase catalytic subunit 2 906 818 ctx cooccurence:604 coexpression:451 textmining:508
Rv0984 moaB2 pterin-4-alpha-carbinolamine dehydratase 856 812 ctx cooccurence:749
Rv0437c psd phosphatidylserine decarboxylase 807 807 ctx neighborhood:802
Rv0435c ATPase 812 804 ctx neighborhood:802

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): molybdopterin molybdenumtransferase
  • Pfam (hmmscan --cut_ga): MoeA_N PF03453.23 (E=3e-44), MoCF_biosynth PF00994.30 (E=2e-30), MoeA_C PF03454.21 (E=1e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177725.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MoeA_N (PF03453.23), MoCF_biosynth (PF00994.30), MoeA_C (PF03454.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0303
  • Curated reference: UniProt P9WJQ5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor mog
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0438c|moeA2
MRSVQEHQRVVAEMMRACRPITVPLTQAQGLVLGGDVVAPLSLPVFDNSAMDGYAVRAEDTSGATPQNPVMLPVAEDIPAGRADMLTLQPVTAHRIMTGAPVPTGATAIVPVEATDGGVDSVAIRQQATPGKHIRRSGEDVAAGTTVLHNGQIVTPAVLGLAAALGLAELPVLPRQRVLVISTGSELASPGTPLQPGQIYESNSIMLAAAVRDAGAAVVATATAGDDVAQFGAILDRYAVDADLIITSGGVSAGAYEVVKDAFGSADYRGGDHGVEFVKVAMQPGMPQGVGRVAGTPIVTLPGNPVSALVSFEVFIRPPLRMAMGLPDPYRPHRSAVLTASLTSPRGKRQFRRAILDHQAGTVISYGPPASHHLRWLASANGLLDIPEDVVEVAAGTQLQVWDLT