moeA2 Resolved · high auto-curated
H37Rv Rv0438c · MTBC0 - ·
405 aa · 526143–527360 (-) ·
RefSeq YP_177725.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | molybdopterin molybdenumtransferase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Molybdopterin molybdenumtransferase. Pfam: MoeA_N (PF03453.23), MoCF_biosynth (PF00994.30), MoeA_C (PF03454.21). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WJQ5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Molybdopterin molybdenumtransferase 2 |
| EC (curated) |
EC 2.10.1.1
|
| Curated function | Catalyzes the insertion of molybdate into adenylated molybdopterin with the concomitant release of AMP. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | moeA |
| eggNOG description | Molybdopterin |
| Orthologous group | COG0303 |
| EC number |
EC 2.10.1.1
|
| KEGG orthology |
K03750
|
| KEGG pathways |
map00790, map01100
|
| Gene Ontology (76) |
GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006139, GO:0006163, GO:0006464, GO:0006725, GO:0006732, GO:0006753 +64 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.682 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 9 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MoeA_N | PF03453.23 | 3.1e-44 | 3–166 | MoeA N-terminal region (domain I and II) |
MoCF_biosynth | PF00994.30 | 1.6e-30 | 180–321 | Probable molybdopterin binding domain |
MoeA_C | PF03454.21 | 1.3e-15 | 336–404 | MoeA C-terminal region (domain IV) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mog (molybdopterin biosynthesis protein), high confidence from genomic context alone (score 949 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2453c mobA |
molybdenum cofactor guanylyltransferase | 957 | 952 | database:900 |
Rv0865 mog |
molybdopterin biosynthesis protein | 960 | 949 ctx | fusion:442 cooccurence:736 database:500 |
Rv3323c moaX |
MoaD-MoaE fusion protein MoaX | 943 | 925 ctx | cooccurence:581 coexpression:805 |
Rv0994 moeA1 |
molybdopterin molybdenumtransferase 1 | 917 | 917 | database:900 |
Rv0345 hyp |
hypothetical protein | 903 | 903 | database:900 |
Rv0371c hyp |
hypothetical protein | 903 | 903 | database:900 |
Rv3111 moaC1 |
cyclic pyranopterin monophosphate synthase accessory protein | 919 | 886 ctx | cooccurence:762 coexpression:430 |
Rv0864 moaC2 |
cyclic pyranopterin monophosphate synthase accessory protein | 884 | 868 ctx | cooccurence:766 coexpression:430 |
Rv3324c moaC3 |
cyclic pyranopterin monophosphate synthase accessory protein | 883 | 867 ctx | cooccurence:763 coexpression:430 |
Rv0869c moaA2 |
molybdenum cofactor biosynthesis protein MoaA | 903 | 864 ctx | cooccurence:767 |
Rv3109 moaA1 |
cyclic pyranopterin monophosphate synthase | 853 | 835 ctx | cooccurence:766 |
Rv0866 moaE2 |
molybdopterin synthase catalytic subunit 2 | 906 | 818 ctx | cooccurence:604 coexpression:451 textmining:508 |
Rv0984 moaB2 |
pterin-4-alpha-carbinolamine dehydratase | 856 | 812 ctx | cooccurence:749 |
Rv0437c psd |
phosphatidylserine decarboxylase | 807 | 807 ctx | neighborhood:802 |
Rv0435c |
ATPase | 812 | 804 ctx | neighborhood:802 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): molybdopterin molybdenumtransferase
- Pfam (hmmscan --cut_ga): MoeA_N PF03453.23 (E=3e-44), MoCF_biosynth PF00994.30 (E=2e-30), MoeA_C PF03454.21 (E=1e-15)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177725.1)
- Domains: Pfam-A via hmmscan --cut_ga — MoeA_N (PF03453.23), MoCF_biosynth (PF00994.30), MoeA_C (PF03454.21)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0303 - Curated reference: UniProt P9WJQ5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
34 functional partner(s); context anchor
mog - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0438c|moeA2 MRSVQEHQRVVAEMMRACRPITVPLTQAQGLVLGGDVVAPLSLPVFDNSAMDGYAVRAEDTSGATPQNPVMLPVAEDIPAGRADMLTLQPVTAHRIMTGAPVPTGATAIVPVEATDGGVDSVAIRQQATPGKHIRRSGEDVAAGTTVLHNGQIVTPAVLGLAAALGLAELPVLPRQRVLVISTGSELASPGTPLQPGQIYESNSIMLAAAVRDAGAAVVATATAGDDVAQFGAILDRYAVDADLIITSGGVSAGAYEVVKDAFGSADYRGGDHGVEFVKVAMQPGMPQGVGRVAGTPIVTLPGNPVSALVSFEVFIRPPLRMAMGLPDPYRPHRSAVLTASLTSPRGKRQFRRAILDHQAGTVISYGPPASHHLRWLASANGLLDIPEDVVEVAAGTQLQVWDLT