moaC2 Resolved · high auto-curated

H37Rv Rv0864 · MTBC0 mtbc0_000919 · 167 aa · 966093–966596 (+) · RefSeq NP_215379.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cyclic pyranopterin monophosphate synthase accessory protein
MTBC0 PGAP re-annotationcyclic pyranopterin monophosphate synthase MoaC
Revised (this work)Cyclic pyranopterin monophosphate synthase MoaC. Pfam: MoaC (PF01967.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJR7 SwissProt · reviewed · Evidence at protein level
UniProt nameCyclic pyranopterin monophosphate synthase 2
EC (curated) EC 4.6.1.17
Curated functionCatalyzes the conversion of (8S)-3',8-cyclo-7,8-dihydroguanosine 5'-triphosphate to cyclic pyranopterin monophosphate (cPMP).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namemoaC
eggNOG descriptionCatalyzes the conversion of (8S)-3',8-cyclo-7,8- dihydroguanosine 5'-triphosphate to cyclic pyranopterin monophosphate (cPMP)
Orthologous groupCOG0315
EC number EC 4.6.1.17
KEGG orthology K03637
KEGG pathways map00790, map01100, map04122

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 10.17% of strains (14775) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MoaCPF01967.28 3.7e-5426–159 MoaC family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: moaA1 (cyclic pyranopterin monophosphate synthase), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3109 moaA1 cyclic pyranopterin monophosphate synthase 999 999 ctx fusion:900 cooccurence:772 coexpression:647 database:900 textmining:901
Rv0869c moaA2 molybdenum cofactor biosynthesis protein MoaA 999 999 ctx fusion:900 cooccurence:773 coexpression:647 database:900 textmining:929
Rv0865 mog molybdopterin biosynthesis protein 999 998 ctx neighborhood:882 fusion:843 cooccurence:730 coexpression:666 textmining:799
Rv0866 moaE2 molybdopterin synthase catalytic subunit 2 998 997 ctx neighborhood:882 cooccurence:474 coexpression:570 database:900 textmining:654
Rv3323c moaX MoaD-MoaE fusion protein MoaX 998 996 ctx cooccurence:486 coexpression:920 database:900 textmining:550
Rv3119 moaE1 molybdopterin synthase catalytic subunit 1 980 978 ctx cooccurence:497 coexpression:560 database:900
Rv3324c moaC3 cyclic pyranopterin monophosphate synthase accessory protein 915 908 database:900
Rv3111 moaC1 cyclic pyranopterin monophosphate synthase accessory protein 913 907 database:900
Rv0984 moaB2 pterin-4-alpha-carbinolamine dehydratase 915 900 ctx cooccurence:737 coexpression:443
Rv0438c moeA2 molybdopterin molybdenumtransferase 884 868 ctx cooccurence:766 coexpression:430
Rv0994 moeA1 molybdopterin molybdenumtransferase 1 874 857 ctx cooccurence:743 coexpression:435
Rv0863 hyp hypothetical protein 816 816 ctx neighborhood:808
Rv0868c moaD2 cyclic pyranopterin monophosphate synthase 813 760 coexpression:505 database:500
Rv0862c hyp hypothetical protein 601 600 ctx neighborhood:599
Rv1335 cysO sulfur carrier protein CysO 555 530 coexpression:515

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: cyclic pyranopterin monophosphate synthase accessory protein
  • MTBC0 PGAP product: cyclic pyranopterin monophosphate synthase MoaC
  • Pfam (hmmscan --cut_ga): MoaC PF01967.28 (E=4e-54)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215379.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MoaC (PF01967.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0315
  • Curated reference: UniProt P9WJR7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor moaA1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000919|Rv0864|moaC2
MARASGASDYRSGELSHQDERGAAHMVDITEKATTKRTAVAAGILRTSAQVVALISTGGLPKGDALATARVAGIMAAKRTSDLIPLCHQLALTGVDVDFTVGQLDIEITATVRSTDRTGVEMEALTAVSVAALTLYDMIKAVDPGALIDDIRVLHKEGGRRGTWTRR