moaC2 Resolved · high auto-curated
H37Rv Rv0864 · MTBC0 mtbc0_000919 ·
167 aa · 966093–966596 (+) ·
RefSeq NP_215379.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | cyclic pyranopterin monophosphate synthase accessory protein |
|---|---|
| MTBC0 PGAP re-annotation | cyclic pyranopterin monophosphate synthase MoaC |
| Revised (this work) | Cyclic pyranopterin monophosphate synthase MoaC. Pfam: MoaC (PF01967.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WJR7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Cyclic pyranopterin monophosphate synthase 2 |
| EC (curated) |
EC 4.6.1.17
|
| Curated function | Catalyzes the conversion of (8S)-3',8-cyclo-7,8-dihydroguanosine 5'-triphosphate to cyclic pyranopterin monophosphate (cPMP). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | moaC |
| eggNOG description | Catalyzes the conversion of (8S)-3',8-cyclo-7,8- dihydroguanosine 5'-triphosphate to cyclic pyranopterin monophosphate (cPMP) |
| Orthologous group | COG0315 |
| EC number |
EC 4.6.1.17
|
| KEGG orthology |
K03637
|
| KEGG pathways |
map00790, map01100, map04122
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 10.17% of strains (14775) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MoaC | PF01967.28 | 3.7e-54 | 26–159 | MoaC family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: moaA1 (cyclic pyranopterin monophosphate synthase), high confidence from genomic context alone (score 999 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3109 moaA1 |
cyclic pyranopterin monophosphate synthase | 999 | 999 ctx | fusion:900 cooccurence:772 coexpression:647 database:900 textmining:901 |
Rv0869c moaA2 |
molybdenum cofactor biosynthesis protein MoaA | 999 | 999 ctx | fusion:900 cooccurence:773 coexpression:647 database:900 textmining:929 |
Rv0865 mog |
molybdopterin biosynthesis protein | 999 | 998 ctx | neighborhood:882 fusion:843 cooccurence:730 coexpression:666 textmining:799 |
Rv0866 moaE2 |
molybdopterin synthase catalytic subunit 2 | 998 | 997 ctx | neighborhood:882 cooccurence:474 coexpression:570 database:900 textmining:654 |
Rv3323c moaX |
MoaD-MoaE fusion protein MoaX | 998 | 996 ctx | cooccurence:486 coexpression:920 database:900 textmining:550 |
Rv3119 moaE1 |
molybdopterin synthase catalytic subunit 1 | 980 | 978 ctx | cooccurence:497 coexpression:560 database:900 |
Rv3324c moaC3 |
cyclic pyranopterin monophosphate synthase accessory protein | 915 | 908 | database:900 |
Rv3111 moaC1 |
cyclic pyranopterin monophosphate synthase accessory protein | 913 | 907 | database:900 |
Rv0984 moaB2 |
pterin-4-alpha-carbinolamine dehydratase | 915 | 900 ctx | cooccurence:737 coexpression:443 |
Rv0438c moeA2 |
molybdopterin molybdenumtransferase | 884 | 868 ctx | cooccurence:766 coexpression:430 |
Rv0994 moeA1 |
molybdopterin molybdenumtransferase 1 | 874 | 857 ctx | cooccurence:743 coexpression:435 |
Rv0863 hyp |
hypothetical protein | 816 | 816 ctx | neighborhood:808 |
Rv0868c moaD2 |
cyclic pyranopterin monophosphate synthase | 813 | 760 | coexpression:505 database:500 |
Rv0862c hyp |
hypothetical protein | 601 | 600 ctx | neighborhood:599 |
Rv1335 cysO |
sulfur carrier protein CysO | 555 | 530 | coexpression:515 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: cyclic pyranopterin monophosphate synthase accessory protein
- MTBC0 PGAP product: cyclic pyranopterin monophosphate synthase MoaC
- Pfam (hmmscan --cut_ga): MoaC PF01967.28 (E=4e-54)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215379.1)
- Domains: Pfam-A via hmmscan --cut_ga — MoaC (PF01967.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0315 - Curated reference: UniProt P9WJR7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
22 functional partner(s); context anchor
moaA1 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000919|Rv0864|moaC2 MARASGASDYRSGELSHQDERGAAHMVDITEKATTKRTAVAAGILRTSAQVVALISTGGLPKGDALATARVAGIMAAKRTSDLIPLCHQLALTGVDVDFTVGQLDIEITATVRSTDRTGVEMEALTAVSVAALTLYDMIKAVDPGALIDDIRVLHKEGGRRGTWTRR