moaX Resolved · high auto-curated

H37Rv Rv3323c · MTBC0 - · 221 aa · 3709049–3709714 H37Rv (-) · RefSeq YP_177959.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)MoaD-MoaE fusion protein MoaX
MTBC0 PGAP re-annotation
Revised (this work)MoaD-MoaE fusion protein MoaX. Pfam: ThiS (PF02597.27), MoaE (PF02391.23).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

In the literature (TB corpus sweep) 7 publications

7 TB publications mention this gene. 7 publication(s) discuss this gene (7 in a M. tuberculosis context, 4 in other mycobacteria — M. smegmatis (4)).

Most recent 5 of 7.
PublicationDate
Structural comparison of three MoaE proteins in Mycobacterium tuberculosis: Insights into molybdopterin synthase assembly and specificity. doi:10.1016/j.bbrc.2025.151945 2025
Assessing the Role of Polyamine Metabolites in Blood and the DNA Methylation of Mycobacterium Tuberculosis in Patients with Multidrug-Resistant Tuberculosis. doi:10.7150/ijms.102568 2025
Analysis of Mycobacterium africanum in the last 17 years in Aragon identifies a specific location of IS6110 in Lineage 6. doi:10.1038/s41598-021-89511-x 2021
Structural analysis of molybdopterin synthases from two mycobacterial pathogens. doi:10.1016/j.bbrc.2019.02.024 2019
Cleavage of molybdopterin synthase MoaD-MoaE linear fusion by JAMM/MPN+ domain containing metalloprotease DR0402 from Deinococcus radiodurans. doi:10.1016/j.bbrc.2018.05.117 2018

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene

NeighbourRv3322c (Rv3322c, - strand)
Overlap4 bp, 1 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): PyrR (pyrR).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index 0.54 (95% CI -1.19 to 2.95). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionThought to be involved in molybdenum cofactor biosynthesis.

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3352c · 100.0% identity
M. orygis RJtmp_003425 · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt Q6MWY3 TrEMBL · unreviewed · Evidence at protein level
UniProt nameMolybdopterin synthase catalytic subunit 1
EC (curated) EC 2.8.1.12
Curated functionConverts molybdopterin precursor Z into molybdopterin. This requires the incorporation of two sulfur atoms into precursor Z to generate a dithiolene group. The sulfur is provided by MoaD.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namemoaE
eggNOG descriptionMolybdopterin
Orthologous groupCOG0314
EC number EC 2.8.1.12
KEGG orthology K03635, K21142
KEGG pathways map00790, map01100, map04122

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.321 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 4 consensus substitution(s)
low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 51/53 (96%) · mean identity 38.1% · 4/4 closest MTBAP relatives
conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 9/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 39.1%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 15 in the ORF — 0 in the essential state, 0 growth-defect, 15 non-essential, 0 growth-advantage. Saturation 0.933, mean read count 205.857142857. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 6 of 16 independent MS datasets
Integrated abundance87.5 ppm · rank 1394/3519 (60.4th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length221 aa
Molecular weight24.1 kDa
Theoretical pI5.05
GRAVY-0.019 (hydrophilic)
Aliphatic index95.7
Aromaticity0.063
Instability index30.2 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ThiSPF02597.27 3.5e-176–82 ThiS family
MoaEPF02391.23 1.3e-3689–200 MoaE protein

Experimental structures (Protein Data Bank) 1 solved

PDBMethodResolutionCoverage
9jbd X-ray diffraction 2.4 Å 66%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 90.2

PDB hitprobTM-scoreE-valueDescription
2wp4-assembly1_A 1.00 0.95 3.7e-19 sig 2wp4-assembly1_A crystal structure of Rv3119 from Mycobacterium tuberculosis
2wp4-assembly1_B 1.00 0.88 1.8e-18 sig 2wp4-assembly1_B crystal structure of Rv3119 from Mycobacterium tuberculosis
6jbz-assembly1_C 1.00 0.91 4.3e-17 sig 6jbz-assembly1_C Structural analysis of molybdopterin synthases from two mycobacteria pathogens
6jc0-assembly1_B 1.00 0.90 2.0e-16 sig 6jc0-assembly1_B Structural analysis of molybdopterin synthases from two mycobacteria pathogens
2q5w-assembly1_E 1.00 0.96 1.5e-15 sig 2q5w-assembly1_E The X-ray Crystal Structure of Molybdopterin Synthase from Staphylococcus aureus

Foldseek search of the AlphaFold DB model (mean pLDDT 90.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 3

Upstream (5' on genome)Rv3322c (- strand, -4 bp gap)
Downstream (3' on genome)moaC3 (- strand, 0 bp gap)
Predicted operon Rv3322c · moaX · moaC3

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (3 TF) Rv0081 (activates) · ramB (represses) · Rv3249c (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: moaC3 (cyclic pyranopterin monophosphate synthase accessory protein), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3324c moaC3 exp cyclic pyranopterin monophosphate synthase accessory protein 999 999 ctx neighborhood:801 cooccurence:471 coexpression:921 database:900 textmining:845
Rv3111 moaC1 exp cyclic pyranopterin monophosphate synthase accessory protein 998 996 ctx cooccurence:466 coexpression:920 database:900 textmining:730
Rv0864 moaC2 exp cyclic pyranopterin monophosphate synthase accessory protein 998 996 ctx cooccurence:486 coexpression:920 database:900 textmining:550
Rv0868c moaD2 exp cyclic pyranopterin monophosphate synthase 997 993 coexpression:498 experimental:868 database:900 textmining:600
Rv3116 moeB2 exp molybdenum cofactor biosynthesis protein MoeB 997 990 coexpression:447 experimental:473 database:934 textmining:735
Rv3206c moeB1 exp adenylyltransferase/sulfurtransferase MoeZ 996 989 coexpression:444 experimental:473 database:934 textmining:718
Rv0866 moaE2 exp molybdopterin synthase catalytic subunit 2 976 975 coexpression:492 experimental:463 database:900
Rv3112 moaD1 exp molybdenum cofactor biosynthesis protein MoaD 974 972 coexpression:494 experimental:463 database:900
Rv3119 moaE1 exp molybdopterin synthase catalytic subunit 1 973 972 coexpression:491 experimental:463 database:900
Rv1335 cysO exp sulfur carrier protein CysO 979 971 coexpression:491 experimental:463 database:900
Rv0438c moeA2 molybdopterin molybdenumtransferase 943 925 ctx cooccurence:581 coexpression:805
Rv0994 moeA1 molybdopterin molybdenumtransferase 1 931 908 ctx cooccurence:487 coexpression:805
Rv3109 moaA1 cyclic pyranopterin monophosphate synthase 969 895 ctx cooccurence:677 coexpression:648 textmining:720
Rv3322c methyltransferase 885 884 ctx neighborhood:882
Rv0869c moaA2 molybdenum cofactor biosynthesis protein MoaA 889 852 ctx cooccurence:547 coexpression:646

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): MoaD-MoaE fusion protein MoaX
  • Pfam (hmmscan --cut_ga): ThiS PF02597.27 (E=4e-17), MoaE PF02391.23 (E=1e-36)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177959.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ThiS (PF02597.27), MoaE (PF02391.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0314
  • Curated reference: UniProt Q6MWY3 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 90.2)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 67 functional partner(s); context anchor moaC3
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3323c|moaX
MITVNVLYFGAVREACKVAHEKISLESGTTVDGLVDQLQIDYPPLADFRKRVRMAVNESIAPASTILDDGDTVAFIPQVAGGSDVYCRLTDEPLSVDEVLNAISGPSQGGAVIFVGTVRNNNNGHEVTKLYYEAYPAMVHRTLMDIIEECERQADGVRVAVAHRTGELRIGDAAVVIGASAPHRAAAFDAARMCIERLKQDVPIWKKEFALDGVEWVANRP