moaX Resolved · high auto-curated
H37Rv Rv3323c · MTBC0 - ·
221 aa · 3709049–3709714 (-) ·
RefSeq YP_177959.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | MoaD-MoaE fusion protein MoaX |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | MoaD-MoaE fusion protein MoaX. Pfam: ThiS (PF02597.27), MoaE (PF02391.23). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
Q6MWY3
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Molybdopterin synthase catalytic subunit 1 |
| EC (curated) |
EC 2.8.1.12
|
| Curated function | Converts molybdopterin precursor Z into molybdopterin. This requires the incorporation of two sulfur atoms into precursor Z to generate a dithiolene group. The sulfur is provided by MoaD. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | moaE |
| eggNOG description | Molybdopterin |
| Orthologous group | COG0314 |
| EC number |
EC 2.8.1.12
|
| KEGG orthology |
K03635, K21142
|
| KEGG pathways |
map00790, map01100, map04122
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.321 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ThiS | PF02597.27 | 3.5e-17 | 6–82 | ThiS family |
MoaE | PF02391.23 | 1.3e-36 | 89–200 | MoaE protein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: moaC3 (cyclic pyranopterin monophosphate synthase accessory protein), high confidence from genomic context alone (score 999 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3324c moaC3 |
cyclic pyranopterin monophosphate synthase accessory protein | 999 | 999 ctx | neighborhood:801 cooccurence:471 coexpression:921 database:900 textmining:845 |
Rv3111 moaC1 |
cyclic pyranopterin monophosphate synthase accessory protein | 998 | 996 ctx | cooccurence:466 coexpression:920 database:900 textmining:730 |
Rv0864 moaC2 |
cyclic pyranopterin monophosphate synthase accessory protein | 998 | 996 ctx | cooccurence:486 coexpression:920 database:900 textmining:550 |
Rv0868c moaD2 |
cyclic pyranopterin monophosphate synthase | 997 | 993 | coexpression:498 experimental:868 database:900 textmining:600 |
Rv3116 moeB2 |
molybdenum cofactor biosynthesis protein MoeB | 997 | 990 | coexpression:447 experimental:473 database:934 textmining:735 |
Rv3206c moeB1 |
adenylyltransferase/sulfurtransferase MoeZ | 996 | 989 | coexpression:444 experimental:473 database:934 textmining:718 |
Rv0866 moaE2 |
molybdopterin synthase catalytic subunit 2 | 976 | 975 | coexpression:492 experimental:463 database:900 |
Rv3112 moaD1 |
molybdenum cofactor biosynthesis protein MoaD | 974 | 972 | coexpression:494 experimental:463 database:900 |
Rv3119 moaE1 |
molybdopterin synthase catalytic subunit 1 | 973 | 972 | coexpression:491 experimental:463 database:900 |
Rv1335 cysO |
sulfur carrier protein CysO | 979 | 971 | coexpression:491 experimental:463 database:900 |
Rv0438c moeA2 |
molybdopterin molybdenumtransferase | 943 | 925 ctx | cooccurence:581 coexpression:805 |
Rv0994 moeA1 |
molybdopterin molybdenumtransferase 1 | 931 | 908 ctx | cooccurence:487 coexpression:805 |
Rv3109 moaA1 |
cyclic pyranopterin monophosphate synthase | 969 | 895 ctx | cooccurence:677 coexpression:648 textmining:720 |
Rv3322c |
methyltransferase | 885 | 884 ctx | neighborhood:882 |
Rv0869c moaA2 |
molybdenum cofactor biosynthesis protein MoaA | 889 | 852 ctx | cooccurence:547 coexpression:646 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): MoaD-MoaE fusion protein MoaX
- Pfam (hmmscan --cut_ga): ThiS PF02597.27 (E=4e-17), MoaE PF02391.23 (E=1e-36)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177959.1)
- Domains: Pfam-A via hmmscan --cut_ga — ThiS (PF02597.27), MoaE (PF02391.23)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0314 - Curated reference: UniProt Q6MWY3 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
67 functional partner(s); context anchor
moaC3 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3323c|moaX MITVNVLYFGAVREACKVAHEKISLESGTTVDGLVDQLQIDYPPLADFRKRVRMAVNESIAPASTILDDGDTVAFIPQVAGGSDVYCRLTDEPLSVDEVLNAISGPSQGGAVIFVGTVRNNNNGHEVTKLYYEAYPAMVHRTLMDIIEECERQADGVRVAVAHRTGELRIGDAAVVIGASAPHRAAAFDAARMCIERLKQDVPIWKKEFALDGVEWVANRP