moaX Resolved · high auto-curated
H37Rv Rv3323c · MTBC0 - ·
221 aa ·
3709049–3709714 H37Rv
(-) ·
RefSeq YP_177959.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | MoaD-MoaE fusion protein MoaX |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | MoaD-MoaE fusion protein MoaX. Pfam: ThiS (PF02597.27), MoaE (PF02391.23). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 7 publications
7 TB publications mention this gene. 7 publication(s) discuss this gene (7 in a M. tuberculosis context, 4 in other mycobacteria — M. smegmatis (4)).
| Publication | Date |
|---|---|
| Structural comparison of three MoaE proteins in Mycobacterium tuberculosis: Insights into molybdopterin synthase assembly and specificity. doi:10.1016/j.bbrc.2025.151945 | 2025 |
| Assessing the Role of Polyamine Metabolites in Blood and the DNA Methylation of Mycobacterium Tuberculosis in Patients with Multidrug-Resistant Tuberculosis. doi:10.7150/ijms.102568 | 2025 |
| Analysis of Mycobacterium africanum in the last 17 years in Aragon identifies a specific location of IS6110 in Lineage 6. doi:10.1038/s41598-021-89511-x | 2021 |
| Structural analysis of molybdopterin synthases from two mycobacterial pathogens. doi:10.1016/j.bbrc.2019.02.024 | 2019 |
| Cleavage of molybdopterin synthase MoaD-MoaE linear fusion by JAMM/MPN+ domain containing metalloprotease DR0402 from Deinococcus radiodurans. doi:10.1016/j.bbrc.2018.05.117 | 2018 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | Rv3322c (Rv3322c, - strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
PyrR (pyrR).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.54 (95% CI -1.19 to 2.95). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Thought to be involved in molybdenum cofactor biosynthesis. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3352c
· 100.0% identity |
|---|---|
| M. orygis |
RJtmp_003425
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
Q6MWY3
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Molybdopterin synthase catalytic subunit 1 |
| EC (curated) |
EC 2.8.1.12
|
| Curated function | Converts molybdopterin precursor Z into molybdopterin. This requires the incorporation of two sulfur atoms into precursor Z to generate a dithiolene group. The sulfur is provided by MoaD. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | moaE |
| eggNOG description | Molybdopterin |
| Orthologous group | COG0314 |
| EC number |
EC 2.8.1.12
|
| KEGG orthology |
K03635, K21142
|
| KEGG pathways |
map00790, map01100, map04122
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.321 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 4 consensus substitution(s) low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 38.1%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 9/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 39.1% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 15 in the ORF — 0 in the essential state, 0 growth-defect, 15 non-essential, 0 growth-advantage. Saturation 0.933, mean read count 205.857142857. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 6 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 87.5 ppm · rank 1394/3519 (60.4th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 221 aa |
|---|---|
| Molecular weight | 24.1 kDa |
| Theoretical pI | 5.05 |
| GRAVY | -0.019 (hydrophilic) |
| Aliphatic index | 95.7 |
| Aromaticity | 0.063 |
| Instability index | 30.2 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ThiS | PF02597.27 | 3.5e-17 | 6–82 | ThiS family |
MoaE | PF02391.23 | 1.3e-36 | 89–200 | MoaE protein |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
9jbd |
X-ray diffraction | 2.4 Å | 66% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 90.2
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2wp4-assembly1_A |
1.00 | 0.95 | 3.7e-19 sig | 2wp4-assembly1_A crystal structure of Rv3119 from Mycobacterium tuberculosis |
2wp4-assembly1_B |
1.00 | 0.88 | 1.8e-18 sig | 2wp4-assembly1_B crystal structure of Rv3119 from Mycobacterium tuberculosis |
6jbz-assembly1_C |
1.00 | 0.91 | 4.3e-17 sig | 6jbz-assembly1_C Structural analysis of molybdopterin synthases from two mycobacteria pathogens |
6jc0-assembly1_B |
1.00 | 0.90 | 2.0e-16 sig | 6jc0-assembly1_B Structural analysis of molybdopterin synthases from two mycobacteria pathogens |
2q5w-assembly1_E |
1.00 | 0.96 | 1.5e-15 sig | 2q5w-assembly1_E The X-ray Crystal Structure of Molybdopterin Synthase from Staphylococcus aureus |
Foldseek search of the AlphaFold DB model (mean pLDDT 90.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | Rv3322c (- strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | moaC3 (- strand, 0 bp gap) |
| Predicted operon |
Rv3322c · moaX · moaC3
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (3 TF) |
Rv0081 (activates) · ramB (represses) · Rv3249c (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: moaC3 (cyclic pyranopterin monophosphate synthase accessory protein), high confidence from genomic context alone (score 999 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3324c moaC3 exp |
cyclic pyranopterin monophosphate synthase accessory protein | 999 | 999 ctx | neighborhood:801 cooccurence:471 coexpression:921 database:900 textmining:845 |
Rv3111 moaC1 exp |
cyclic pyranopterin monophosphate synthase accessory protein | 998 | 996 ctx | cooccurence:466 coexpression:920 database:900 textmining:730 |
Rv0864 moaC2 exp |
cyclic pyranopterin monophosphate synthase accessory protein | 998 | 996 ctx | cooccurence:486 coexpression:920 database:900 textmining:550 |
Rv0868c moaD2 exp |
cyclic pyranopterin monophosphate synthase | 997 | 993 | coexpression:498 experimental:868 database:900 textmining:600 |
Rv3116 moeB2 exp |
molybdenum cofactor biosynthesis protein MoeB | 997 | 990 | coexpression:447 experimental:473 database:934 textmining:735 |
Rv3206c moeB1 exp |
adenylyltransferase/sulfurtransferase MoeZ | 996 | 989 | coexpression:444 experimental:473 database:934 textmining:718 |
Rv0866 moaE2 exp |
molybdopterin synthase catalytic subunit 2 | 976 | 975 | coexpression:492 experimental:463 database:900 |
Rv3112 moaD1 exp |
molybdenum cofactor biosynthesis protein MoaD | 974 | 972 | coexpression:494 experimental:463 database:900 |
Rv3119 moaE1 exp |
molybdopterin synthase catalytic subunit 1 | 973 | 972 | coexpression:491 experimental:463 database:900 |
Rv1335 cysO exp |
sulfur carrier protein CysO | 979 | 971 | coexpression:491 experimental:463 database:900 |
Rv0438c moeA2 |
molybdopterin molybdenumtransferase | 943 | 925 ctx | cooccurence:581 coexpression:805 |
Rv0994 moeA1 |
molybdopterin molybdenumtransferase 1 | 931 | 908 ctx | cooccurence:487 coexpression:805 |
Rv3109 moaA1 |
cyclic pyranopterin monophosphate synthase | 969 | 895 ctx | cooccurence:677 coexpression:648 textmining:720 |
Rv3322c |
methyltransferase | 885 | 884 ctx | neighborhood:882 |
Rv0869c moaA2 |
molybdenum cofactor biosynthesis protein MoaA | 889 | 852 ctx | cooccurence:547 coexpression:646 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): MoaD-MoaE fusion protein MoaX
- Pfam (hmmscan --cut_ga): ThiS PF02597.27 (E=4e-17), MoaE PF02391.23 (E=1e-36)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177959.1)
- Domains: Pfam-A via hmmscan --cut_ga — ThiS (PF02597.27), MoaE (PF02391.23)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0314 - Curated reference: UniProt Q6MWY3 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 90.2)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
67 functional partner(s); context anchor
moaC3 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3323c|moaX MITVNVLYFGAVREACKVAHEKISLESGTTVDGLVDQLQIDYPPLADFRKRVRMAVNESIAPASTILDDGDTVAFIPQVAGGSDVYCRLTDEPLSVDEVLNAISGPSQGGAVIFVGTVRNNNNGHEVTKLYYEAYPAMVHRTLMDIIEECERQADGVRVAVAHRTGELRIGDAAVVIGASAPHRAAAFDAARMCIERLKQDVPIWKKEFALDGVEWVANRP
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for moaX? Email the maintainer — the message is pre-filled with this gene's details.