Rv3122 Still unknown · low
H37Rv Rv3122 · MTBC0 - ·
156 aa ·
3488089–3488559 H37Rv
(+) ·
RefSeq NP_217638.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Conserved hypothetical protein; DUF domain(s) DUF6788. Function unknown. Foldseek best (non-significant) hit: 2w9j-assembly1_A The crystal structure of SRP14 from the Schizosacchar (prob 0.41, TM 0.31). |
| Functional category (TubercuList) | conserved hypotheticals |
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) never studied
No TB publication mentions this locus tag in its title or abstract (sweep of a ~330k-abstract PubMed TB corpus). This gene is genuinely unstudied: its darkness reflects absence of investigation, not failure of investigation.
An antigen status or a virulence phenotype is NOT a molecular function: the verdict stays unchanged. This layer adds the missing context, it does not requalify the gene. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep of title+abstract: the H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 33% of residues (metapredict) · mean AlphaFold pLDDT 83.4 |
|---|---|
| Disordered regions | 2 IDR(s), longest 35 aa [0-17, 121-156] |
carries a substantial disordered region (52/156 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
Binding-pocket screen (P2Rank, geometric prediction) detector blind at this length
| Pockets found | 1 (best probability 0.01) |
|---|---|
| Model length screened | 156 aa |
Read with care. This protein (156 aa) is below the size where this detector has meaningful power: on proven enzymes, only 3.8% (1/26) under 200 aa reach the P2Rank confidence threshold, versus 60.5% (75/124) above it (P16.3b calibration, negative control EsxA/EsxB-scale panel). A negative or weak pocket result here should NOT be read as evidence against a ligand-binding role -- the test essentially has no power at this length, not that the protein lacks a site. P16.3e, calibration phase72b_pocket_calibration.py, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Rv1828/SigH (Rv1828 or sigH).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 1.76 (95% CI -0.10 to 4.97). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3145
· 99.4% identity |
|---|
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O07033
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | DUF6788 domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2C62F |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 4 missense, 1 nonsense, 0 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.20% of strains (291) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacterium
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 2/53 (4%) · mean identity 79.0%
· 1/4 closest MTBAP relatives present in a subset of the genus (2/53 NTM; in 1 of the 4 closest MTBAP relatives) — partial/intermediate conservation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Regions of Difference (lineage deletions)
| RD | Gene overlap | Deleted in lineages |
|---|---|---|
RD12can |
100% | Orygis (82%), Canettii (81%) |
RD12oryx* |
100% | Orygis (99%), Canettii (81%) |
This locus overlaps a Region of Difference — a large deletion that is absent in the listed lineages (from the consolidated MTBC RD analysis over ~145 000 strains; H37Rv coordinates). The gene-overlap column is the fraction of the gene inside the RD. RD deletions are classic lineage markers (e.g. RD9 absent in the animal / M. africanum lineages); a gene deleted in a whole lineage is dispensable there.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 8 in the ORF — 0 in the essential state, 0 growth-defect, 8 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 243.625. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 8 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 8 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB)
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness after prolonged in vitro passage (in vitro passage) | -2.05 | 0.035 | required |
Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 2 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 0.24 ppm · rank 3421/3519 (2.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 156 aa |
|---|---|
| Molecular weight | 17.2 kDa |
| Theoretical pI | 9.46 |
| GRAVY | -0.921 (hydrophilic) |
| Aliphatic index | 54.5 |
| Aromaticity | 0.058 |
| Instability index | 49.5 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF6788 | PF20586.4 | 1.3e-16 | 21–98 | Domain of unknown function (DUF6788) |
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 90.6 (very high). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
2w9j-assembly1_A |
0.41 | 0.31 | 9.7e-02 | 2w9j-assembly1_A The crystal structure of SRP14 from the Schizosaccharomyces pombe signal recognition particle |
3v47-assembly1_C |
0.14 | 0.42 | 1.6e+00 | 3v47-assembly1_C Crystal structure of the N-terminal fragment of zebrafish TLR5 in complex with Salmonella flagellin |
5m3k-assembly1_E |
0.11 | 0.40 | 3.4e+00 | 5m3k-assembly1_E A multi-component acyltransferase PhlABC from Pseudomonas protegens |
7qcd-assembly1_A |
0.11 | 0.43 | 2.5e+00 | 7qcd-assembly1_A CryoEM structure of the Smc5/6-holocomplex (composite structure) |
6vy1-assembly1_G |
0.09 | 0.33 | 2.1e+00 | 6vy1-assembly1_G Cryo-EM structure of filamentous PFD from Methanocaldococcus jannaschii |
4rbr-assembly1_B |
0.07 | 0.40 | 5.0e+00 | 4rbr-assembly1_B Crystal structure of Repressor of Toxin (Rot), a central regulator of Staphylococcus aureus virulence |
4r79-assembly1_B |
0.05 | 0.18 | 9.8e-01 | 4r79-assembly1_B Mos1 transposase paired-end complex with left transposon end |
2pmz-assembly2_V |
0.04 | 0.23 | 3.2e+00 | 2pmz-assembly2_V Archaeal RNA polymerase from Sulfolobus solfataricus |
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | cyp141 (+ strand, 377 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3123 (+ strand, 9 bp gap) |
| Predicted operon |
Rv3122 · Rv3123
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
csoR (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3123 hyp |
hypothetical protein | 773 | 773 ctx | neighborhood:770 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): DUF6788 PF20586.4 (E=1e-16)
- Foldseek best: 2w9j-assembly1_A The crystal structure of SRP14 from the Schizosaccharomyces pom (prob 0.41, E=1e-01, TM=0.31)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217638.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF6788 (PF20586.4)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2C62F - Curated reference: UniProt O07033 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 90.6, very high)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 83.4)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 1 functional partner(s)
- Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Regions of Difference: consolidated MTBC RD analysis (H37Rv coordinates); RD framework from Brosch et al. 2002 (doi:10.1073/pnas.052548299) and Gagneux & Small 2007 (doi:10.1016/S1473-3099(07)70108-1)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3122| MYSGCWINNQNGETRVGEDSLEDLEQRRARLYDQLAATGDFRRGSISENYRRCGKPNCVCAQEGHPGHGPRYLWTRTVAGRGTKGRQLSVEEVDKVRAELANYHRFAQVSEQIVAVNEAICEARPPNPAATAPPAGTTGHKKGGSATRSRRSSPPR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv3122? Email the maintainer — the message is pre-filled with this gene's details.