tsnR Resolved · high auto-curated

H37Rv Rv1644 · MTBC0 mtbc0_001753 · 260 aa · 1865627–1866409 (+) · RefSeq NP_216160.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)23S rRNA methyltransferase TsnR
MTBC0 PGAP re-annotationRNA methyltransferase
Revised (this work)RNA methyltransferase. Pfam: MRM3-like_sub_bind (PF22435.2), SpoU_sub_bind (PF08032.18), SpoU_methylase (PF00588.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P94978 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible 23S rRNA methyltransferase TsnR

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred nametsnR
eggNOG descriptionBelongs to the class IV-like SAM-binding methyltransferase superfamily. RNA methyltransferase TrmH family
Orthologous groupCOG0566
KEGG orthology K03437

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.194 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MRM3-like_sub_bindPF22435.2 5.7e-118–90 MRM3-like substrate binding domain
SpoU_sub_bindPF08032.18 2.5e-0728–94 RNA 2'-O ribose methyltransferase substrate binding
SpoU_methylasePF00588.25 2.4e-38109–251 SpoU rRNA Methylase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplT (50S ribosomal protein L20), high confidence from genomic context alone (score 934 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1643 rplT 50S ribosomal protein L20 936 934 ctx neighborhood:833 experimental:400
Rv2420c rsfS hyp hypothetical protein 819 811 experimental:763
Rv1641 infC initiation factor IF-3 798 799 ctx neighborhood:723
Rv1642 rpmI 50S ribosomal protein L35 783 778 ctx neighborhood:765
Rv3456c rplQ 50S ribosomal protein L17 773 770 experimental:739
Rv0723 rplO 50S ribosomal protein L15 756 756 experimental:732
Rv2442c rplU 50S ribosomal protein L21 750 750 experimental:739
Rv0715 rplX 50S ribosomal protein L24 734 735 experimental:676
Rv0640 rplK 50S ribosomal protein L11 715 716 experimental:696
Rv3443c rplM 50S ribosomal protein L13 722 709 experimental:687
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 727 703 ctx neighborhood:456
Rv0701 rplC 50S ribosomal protein L3 704 690 experimental:664
Rv2902c rnhB ribonuclease HII 678 662 coexpression:594
Rv1540 RNA pseudouridine synthase 647 629 experimental:466
Rv1023 eno enolase 592 592 database:546

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 23S rRNA methyltransferase TsnR
  • MTBC0 PGAP product: RNA methyltransferase
  • Pfam (hmmscan --cut_ga): MRM3-like_sub_bind PF22435.2 (E=6e-11), SpoU_sub_bind PF08032.18 (E=2e-07), SpoU_methylase PF00588.25 (E=2e-38)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216160.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MRM3-like_sub_bind (PF22435.2), SpoU_sub_bind (PF08032.18), SpoU_methylase (PF00588.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0566
  • Curated reference: UniProt P94978 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 82 functional partner(s); context anchor rplT
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001753|Rv1644|tsnR
MLTERSARVATAVKLHRHVGRRRAGRFLAEGPNLVAAALARGLVREVFVTEVAARRHELLLAAHEASVHLVTERAAKALSDTVTPAGLVAVCDLPATRLEDVLAGSPQLIAVTVEIREPGNAGTVIRIADAMGAAAVILAGRSVDPYNGKCLRASTGSIFAIPVVVAPDVGAAIADLRAAGLQVLATAVDGEMALDDADRLLAEPTAWLFGPEAHGLSAEIAALADHRVHIPMSGGAESLNVAAAAAICLYESARALGRR