tsnR Resolved · high auto-curated
H37Rv Rv1644 · MTBC0 mtbc0_001753 ·
260 aa ·
1865627–1866409 MTBC0
(+) ·
RefSeq NP_216160.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 23S rRNA methyltransferase TsnR |
|---|---|
| MTBC0 PGAP re-annotation | RNA methyltransferase |
| Revised (this work) | RNA methyltransferase. Pfam: MRM3-like_sub_bind (PF22435.2), SpoU_sub_bind (PF08032.18), SpoU_methylase (PF00588.25). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (3 in a M. tuberculosis context, 1 in other mycobacteria — M. leprae (1)).
| Publication | Date |
|---|---|
| Comparative In Vitro Drug Susceptibility Study of Five Oxazolidinones Against Mycobacterium tuberculosis in Hainan, China. doi:10.3390/pathogens14030218 | 2025 |
| Mechanisms of Linezolid Resistance in Mycobacteria. doi:10.3390/ph16060784 | 2023 |
| Diagnosis of tuberculosis in an Indian population by an indirect ELISA protocol based on detection of Antigen 85 complex: a prospective cohort study. doi:10.1186/1471-2334-7-74 | 2007 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.30 (95% CI -1.69 to 2.98). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | rRNA modification |
|---|---|
| Mycobrowser EC |
2.1.1.-
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1671
· 99.2% identity |
|---|---|
| M. leprae |
ML1397
· 73.2% identity |
| M. marinum |
MMAR_2451
· 75.9% identity |
| M. smegmatis |
MSMEG_3790
· 69.7% identity |
| M. orygis |
RJtmp_001719
· 99.2% identity |
| M. abscessus |
MAB_2324
· 63.1% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P94978
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible 23S rRNA methyltransferase TsnR |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | tsnR |
| eggNOG description | Belongs to the class IV-like SAM-binding methyltransferase superfamily. RNA methyltransferase TrmH family |
| Orthologous group | COG0566 |
| KEGG orthology |
K03437
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.194 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 77.1%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 49.2% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | GA · growth-advantage |
|---|---|
| What the call means | growth-advantage: insertions enriched |
| TA sites (Himar1) | 11 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 11 growth-advantage. Saturation 1.000, mean read count 247.454545455. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Conditional fitness (RB-TnSeq, 95 conditions) stress
| Condition | Group | Direction | log2 fitness | t |
|---|---|---|---|---|
| Linezolid | stress | mutant enriched (loss advantageous) | 1.626 | 12.32 |
Randomly-barcoded transposon screen across 95 carbon/nitrogen sources, pH, stressors and antibiotics (1 condition-specific phenotype(s) for this gene). A conditional fitness phenotype is a context lead, not a proven function, and never changes the verdict here. Note the blind spot: RB-TnSeq cannot measure essential genes. Source: RB-TnSeq 95-condition barcoded transposon screen, Mtb (PLoS Biol 2026, doi:10.1371/journal.pbio.3003529).
Proteomics (mass spectrometry) detected
| MS detection | detected in 7 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 5.37 ppm · rank 2915/3519 (17.2th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 260 aa |
|---|---|
| Molecular weight | 26.9 kDa |
| Theoretical pI | 6.45 |
| GRAVY | 0.377 (hydrophobic) |
| Aliphatic index | 113.2 |
| Aromaticity | 0.027 |
| Instability index | 36.7 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MRM3-like_sub_bind | PF22435.2 | 5.7e-11 | 8–90 | MRM3-like substrate binding domain |
SpoU_sub_bind | PF08032.18 | 2.5e-07 | 28–94 | RNA 2'-O ribose methyltransferase substrate binding |
SpoU_methylase | PF00588.25 | 2.4e-38 | 109–251 | SpoU rRNA Methylase family |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.5
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
7qiu-assembly1_B |
1.00 | 0.90 | 7.0e-22 sig | 7qiu-assembly1_B YsgA 23s RNA methyltransferase from Bacillus subtilis |
4x3m-assembly1_B |
1.00 | 0.87 | 1.6e-22 sig | 4x3m-assembly1_B Crystal Structure of TTHA0275 from Thermus thermophilus (HB8) in complex with Adenosine in space group P212121 |
1x7p-assembly1_A |
1.00 | 0.86 | 4.9e-21 sig | 1x7p-assembly1_A Crystal structure of the SpoU Methyltransferase AviRb from Streptomyces viridochromogenes in complex with the cofactor AdoMet |
1ipa-assembly1_A |
1.00 | 0.86 | 1.7e-20 sig | 1ipa-assembly1_A CRYSTAL STRUCTURE OF RNA 2'-O RIBOSE METHYLTRANSFERASE |
1x7o-assembly1_B |
1.00 | 0.85 | 1.1e-20 sig | 1x7o-assembly1_B Crystal structure of the SpoU Methyltransferase AviRb from Streptomyces viridochromogenes |
Foldseek search of the AlphaFold DB model (mean pLDDT 95.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | rplT (+ strand, 32 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1645c (- strand, 10 bp gap) |
| Predicted operon |
rplT · tsnR
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: rplT (50S ribosomal protein L20), high confidence from genomic context alone (score 934 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1643 rplT exp |
50S ribosomal protein L20 | 936 | 934 ctx | neighborhood:833 experimental:400 |
Rv2420c rsfS hyp exp |
hypothetical protein | 819 | 811 | experimental:763 |
Rv1641 infC |
initiation factor IF-3 | 798 | 799 ctx | neighborhood:723 |
Rv1642 rpmI |
50S ribosomal protein L35 | 783 | 778 ctx | neighborhood:765 |
Rv3456c rplQ exp |
50S ribosomal protein L17 | 773 | 770 | experimental:739 |
Rv0723 rplO exp |
50S ribosomal protein L15 | 756 | 756 | experimental:732 |
Rv2442c rplU exp |
50S ribosomal protein L21 | 750 | 750 | experimental:739 |
Rv0715 rplX exp |
50S ribosomal protein L24 | 734 | 735 | experimental:676 |
Rv0640 rplK exp |
50S ribosomal protein L11 | 715 | 716 | experimental:696 |
Rv3443c rplM exp |
50S ribosomal protein L13 | 722 | 709 | experimental:687 |
Rv1650 pheT |
phenylalanine--tRNA ligase subunit beta | 727 | 703 ctx | neighborhood:456 |
Rv0701 rplC exp |
50S ribosomal protein L3 | 704 | 690 | experimental:664 |
Rv2902c rnhB |
ribonuclease HII | 678 | 662 | coexpression:594 |
Rv1540 exp |
RNA pseudouridine synthase | 647 | 629 | experimental:466 |
Rv1023 eno exp |
enolase | 592 | 592 | database:546 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 23S rRNA methyltransferase TsnR
- MTBC0 PGAP product: RNA methyltransferase
- Pfam (hmmscan --cut_ga): MRM3-like_sub_bind PF22435.2 (E=6e-11), SpoU_sub_bind PF08032.18 (E=2e-07), SpoU_methylase PF00588.25 (E=2e-38)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216160.1)
- Domains: Pfam-A via hmmscan --cut_ga — MRM3-like_sub_bind (PF22435.2), SpoU_sub_bind (PF08032.18), SpoU_methylase (PF00588.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0566 - Curated reference: UniProt P94978 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.5)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
82 functional partner(s); context anchor
rplT - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001753|Rv1644|tsnR MLTERSARVATAVKLHRHVGRRRAGRFLAEGPNLVAAALARGLVREVFVTEVAARRHELLLAAHEASVHLVTERAAKALSDTVTPAGLVAVCDLPATRLEDVLAGSPQLIAVTVEIREPGNAGTVIRIADAMGAAAVILAGRSVDPYNGKCLRASTGSIFAIPVVVAPDVGAAIADLRAAGLQVLATAVDGEMALDDADRLLAEPTAWLFGPEAHGLSAEIAALADHRVHIPMSGGAESLNVAAAAAICLYESARALGRR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for tsnR? Email the maintainer — the message is pre-filled with this gene's details.