trmI Resolved · high auto-curated

H37Rv Rv2118c · MTBC0 mtbc0_002250 · 280 aa · 2404733–2405575 (-) · RefSeq NP_216634.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)tRNA (adenine(58)-N(1))-methyltransferase
MTBC0 PGAP re-annotationtRNA (adenine(58)-N(1))-methyltransferase TrmI
Revised (this work)TRNA (adenine(58)-N(1))-methyltransferase TrmI. Pfam: TrmI-like_N (PF14801.13), GCD14 (PF08704.17), PCMT (PF01135.26), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFZ1 SwissProt · reviewed · Evidence at protein level
UniProt nametRNA
EC (curated) EC 2.1.1.220
Curated functionCatalyzes the S-adenosyl-L-methionine-dependent formation of N(1)-methyladenine at position 58 (m1A58) in tRNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred nametrmI
eggNOG descriptionCatalyzes the S-adenosyl-L-methionine-dependent formation of N(1)-methyladenine at position 58 (m1A58) in tRNA
Orthologous groupCOG2519
EC number EC 2.1.1.219, EC 2.1.1.220
KEGG orthology K07442
Gene Ontology (57) GO:0001510, GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005886, GO:0006139, GO:0006396, GO:0006399, GO:0006400 +45 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.366 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TrmI-like_NPF14801.13 1.2e-245–54 TrmI-like N-terminal
GCD14PF08704.17 1.7e-1973–237 tRNA methyltransferase complex GCD14 subunit
PCMTPF01135.26 9.6e-0773–204 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
Methyltransf_25PF13649.13 1.2e-07103–197 Methyltransferase domain
Methyltransf_11PF08241.19 1.8e-04104–200 Methyltransferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpoZ (DNA-directed RNA polymerase subunit omega), medium confidence from genomic context alone (score 629 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0208c trmB tRNA (guanine-N(7)-)-methyltransferase 886 859 coexpression:643 database:540
Rv2119 hyp hypothetical protein 785 786 ctx neighborhood:785
Rv0722 rpmD 50S ribosomal protein L30 719 720 coexpression:684
Rv2689c hyp hypothetical protein 705 662 coexpression:662
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 628 629 ctx cooccurence:559
Rv1440 secG protein-export membrane protein SecG 585 586 ctx cooccurence:585
Rv1830 HTH-type transcriptional regulator 584 584 ctx cooccurence:582
Rv3859c gltB glutamate synthase large subunit 545 545 ctx neighborhood:544
Rv1010 ksgA rRNA small subunit methyltransferase A 539 512 coexpression:414
Rv3260c whiB2 transcriptional regulator WhiB2 510 511 ctx cooccurence:508
Rv3219 whiB1 transcriptional regulator WhiB1 507 508 ctx cooccurence:505
Rv2613c AP-4-A phosphorylase 486 486 ctx cooccurence:482
Rv0651 rplJ 50S ribosomal protein L10 484 485 coexpression:426
Rv1407 fmu 16S rRNA m5C967 methyltransferase 541 475
Rv3457c rpoA DNA-directed RNA polymerase subunit alpha 473 473 coexpression:410

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: tRNA (adenine(58)-N(1))-methyltransferase
  • MTBC0 PGAP product: tRNA (adenine(58)-N(1))-methyltransferase TrmI
  • Pfam (hmmscan --cut_ga): TrmI-like_N PF14801.13 (E=1e-24), GCD14 PF08704.17 (E=2e-19), PCMT PF01135.26 (E=1e-06), Methyltransf_25 PF13649.13 (E=1e-07), Methyltransf_11 PF08241.19 (E=2e-04)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216634.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TrmI-like_N (PF14801.13), GCD14 (PF08704.17), PCMT (PF01135.26), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2519
  • Curated reference: UniProt P9WFZ1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 42 functional partner(s); context anchor rpoZ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002250|Rv2118c|trmI
MSATGPFSIGERVQLTDAKGRRYTMSLTPGAEFHTHRGSIAHDAVIGLEQGSVVKSSNGALFLVLRPLLVDYVMSMPRGPQVIYPKDAAQIVHEGDIFPGARVLEAGAGSGALTLSLLRAVGPAGQVISYEQRADHAEHARRNVSGCYGQPPDNWRLVVSDLADSELPDGSVDRAVLDMLAPWEVLDAVSRLLVAGGVLMVYVATVTQLSRIVEALRAKQCWTEPRAWETLQRGWNVVGLAVRPQHSMRGHTAFLVATRRLAPGAVAPAPLGRKREGRDG