rsmI Resolved · high auto-curated

H37Rv Rv1003 · MTBC0 mtbc0_001078 · 285 aa · 1127358–1128215 (+) · RefSeq NP_215519.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)rRNA small subunit methyltransferase I
MTBC0 PGAP re-annotation16S rRNA (cytidine(1402)-2'-O)-methyltransferase
Revised (this work)16S rRNA (cytidine(1402)-2'-O)-methyltransferase. Pfam: TP_methylase (PF00590.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGW7 SwissProt · reviewed · Evidence at protein level
UniProt nameRibosomal RNA small subunit methyltransferase I
EC (curated) EC 2.1.1.198
Curated functionCatalyzes the 2'-O-methylation of the ribose of cytidine 1402 (C1402) in 16S rRNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namersmI
eggNOG descriptionCatalyzes the 2'-O-methylation of the ribose of cytidine 1402 (C1402) in 16S rRNA
Orthologous groupCOG0313
EC number EC 2.1.1.198
KEGG orthology K07056
Gene Ontology (41) GO:0000154, GO:0000451, GO:0000453, GO:0001510, GO:0005575, GO:0005623, GO:0005886, GO:0006139, GO:0006364, GO:0006396, GO:0006725, GO:0006807 +29 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TP_methylasePF00590.26 1.3e-2711–208 Tetrapyrrole (Corrin/Porphyrin) Methylases

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pmt (dolichyl-phosphate-mannose--protein mannosyltransferase), high confidence from genomic context alone (score 786 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1002c pmt dolichyl-phosphate-mannose--protein mannosyltransferase 786 786 ctx neighborhood:783
Rv3752c tadA cytidine/deoxycytidylate deaminase 684 684 ctx fusion:662
Rv3423c alr alanine racemase 564 564 ctx cooccurence:432
Rv2689c hyp hypothetical protein 592 536 ctx cooccurence:490
Rv2153c murG UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol-N-acetylglucosamine transferase 434 435 ctx cooccurence:414
Rv2150c ftsZ cell division protein FtsZ 561 428 ctx cooccurence:413
Rv2364c era GTPase Era 455 427 ctx cooccurence:409
Rv2344c dgt deoxyguanosine triphosphate triphosphohydrolase 426 426 coexpression:416
Rv2902c rnhB ribonuclease HII 426 406
Rv2165c rsmH rRNA small subunit methyltransferase H 978 399 textmining:965
Rv2455c korA 2-oxoglutarate oxidoreductase subunit KorA 408 386
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 483 319
Rv0640 rplK 50S ribosomal protein L11 405 308
Rv3919c gid 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG 720 286 textmining:625
Rv1407 fmu 16S rRNA m5C967 methyltransferase 553 258 textmining:423

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: rRNA small subunit methyltransferase I
  • MTBC0 PGAP product: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase
  • Pfam (hmmscan --cut_ga): TP_methylase PF00590.26 (E=1e-27)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215519.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TP_methylase (PF00590.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0313
  • Curated reference: UniProt P9WGW7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s); context anchor pmt
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001078|Rv1003|rsmI
MSSGRLLLGATPLGQPSDASPRLAAALATADVVAAEDTRRVRKLAKALDIRIGGRVVSLFDRVEALRVTALLDAINNGATVLVVSDAGTPVISDPGYRLVAACIDAGVSVTCLPGPSAVTTALVMSGLPAEKFCFEGFAPRKGAARRAWLAELAEERRTCVFFESPRRLAACLNDAVEQLGGARPAAICRELTKVHEEVVRGSLDELAIWAAGGVLGEITVVVAGAAPHAELSSLIAQVEEFVAAGIRVKDACSEVAAAHPGVRTRQLYDAVLQSRRETGGPAQP