Rv2037c Family assigned · medium auto-curated

H37Rv Rv2037c · MTBC0 mtbc0_002170 · 324 aa · 2311360–2312334 (-) · RefSeq NP_216553.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationpatatin-like phospholipase family protein
Revised (this work)Patatin-like phospholipase family protein. Pfam: Patatin (PF01734.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt L0TB61 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionPhospholipase
Orthologous groupCOG1752
KEGG orthology K07001

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.895 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 10 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PatatinPF01734.28 1.1e-3311–209 Patatin-like phospholipase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2041c (sugar ABC transporter substrate-binding lipoprotein), high confidence from genomic context alone (score 827 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2041c sugar ABC transporter substrate-binding lipoprotein 827 827 ctx neighborhood:774
Rv2039c sugar ABC transporter permease 812 812 ctx neighborhood:807
Rv2038c ugpC sugar ABC transporter ATP-binding protein 807 806 ctx neighborhood:801
Rv2040c sugar ABC transporter permease 785 786 ctx neighborhood:781
Rv2043c pncA pyrazinamidase/nicotinamidase PncA 674 675 ctx neighborhood:664
Rv2042c hyp hypothetical protein 670 670 ctx neighborhood:656
Rv2044c hyp hypothetical protein 555 555 ctx neighborhood:550
Rv0629c recD exonuclease V subunit alpha RecD 514 514 ctx neighborhood:511
Rv0631c recC exonuclease V subunit gamma RecC 513 514 ctx neighborhood:511
Rv0630c recB exonuclease V subunit beta RecB 513 513 ctx neighborhood:511
Rv1063c NTE family protein 426 427 ctx cooccurence:425
Rv2045c lipT carboxylesterase LipT 414 413 ctx neighborhood:406
Rv3600c coaX type III pantothenate kinase 874 74 textmining:870
Rv2225 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase 662 72 textmining:651
Rv2003c hyp hypothetical protein 805 55 textmining:803

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: patatin-like phospholipase family protein
  • Pfam (hmmscan --cut_ga): Patatin PF01734.28 (E=1e-33)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216553.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Patatin (PF01734.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1752
  • Curated reference: UniProt L0TB61 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor Rv2041c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002170|Rv2037c|
MALVSTARVDLVCEGGGVRGIGLVGAVDALADAGYRFPRVAGSSAGAIVASLVAALQTAGEPVTRLAEMMRSIDYPKFLDRNLIGHVPLIGGGLSLLLSDGVYRGAYLEQLLGGLLADLGVHTFGDLRTGEAPEQFAWSLVVTASDLSRRRLVRIPWDLDSYGIHPDDFSVARAVHASSAIPFVFEPVRVRGATWVDGGLLSNFPVALFDRTDAEPRWPTFGIRLSARPGIPPTRPVQGPVSLGIAAIETLVSNQDNAYIDDPCTVRRTIFVPAHDVSPIDFDITAEQREALYQRGFQAGQKFLANWNYADYLADCGGPFTPSL