Rv2037c Family assigned · medium auto-curated

H37Rv Rv2037c · MTBC0 mtbc0_002170 · 324 aa · 2311360–2312334 MTBC0 (-) · RefSeq NP_216553.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv2025c (Rv2025c) — family_assigned: cation diffusion facilitator family transporter Rv2026c (Rv2026c) — requalified: universal stress protein Rv2026c dosT (Rv2027c) — requalified: two-component system sensor histidine kinase DosT dosT Rv2028c (Rv2028c) — requalified: universal stress protein Rv2028c pfkB (Rv2029c) — family_assigned: 1-phosphofructokinase family hexose kinase pfkB Rv2030c (Rv2030c) — family_assigned: erythromycin esterase family protein Rv2030c hspX (Rv2031c) — requalified: alpha-crystallin HspX acg (Rv2032) — family_assigned: FMN-binding protein Acg acg Rv2033c (Rv2033c) — family_assigned: DUF3097 domain-containing protein Rv2033c Rv2034 (Rv2034) — family_assigned: metalloregulator ArsR/SmtB family transcription factor Rv2035 (Rv2035) — family_assigned: SRPBCC family protein Rv2036 (Rv2036) — family_assigned: maleylpyruvate isomerase family mycothiol-dependent enzyme Rv2037c (Rv2037c) — family_assigned: patatin-like phospholipase family protein Rv2037c ugpC (Rv2038c) — family_assigned: sn-glycerol-3-phosphate ABC transporter ATP-binding protein ugpC Rv2039c (Rv2039c) — family_assigned: carbohydrate ABC transporter permease Rv2039c Rv2040c (Rv2040c) — family_assigned: sugar ABC transporter permease Rv2040c Rv2041c (Rv2041c) — family_assigned: sugar ABC transporter substrate-binding protein Rv2041c Rv2042c (Rv2042c) — family_assigned: ketosteroid isomerase family protein pncA (Rv2043c) — requalified: pyrazinamidase PncA lppI (Rv2046) — family_assigned: hypothetical protein Rv2047c (Rv2047c) — family_assigned: sugar epimerase family protein Rv2047c pks12 (Rv2048c) — requalified: type I polyketide synthase 2 300 kb 2 304 kb 2 308 kb 2 312 kb 2 316 kb 2 320 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationpatatin-like phospholipase family protein
Revised (this work)Patatin-like phospholipase family protein. Pfam: Patatin (PF01734.28).
Functional category (TubercuList)cell wall and cell processes

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 1 publication

1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).

PublicationDate
Rv2037c, a stress induced conserved hypothetical protein of Mycobacterium tuberculosis, is a phospholipase: Role in cell wall modulation and intracellular survival. doi:10.1016/j.ijbiomac.2020.03.037 2020

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 0.99 (95% CI -1.38 to 4.14). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2063c · 99.7% identity
M. leprae ML1423c · 81.0% identity
M. marinum MMAR_3010 · 88.4% identity
M. orygis RJtmp_002109 · 99.7% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt L0TB61 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionPhospholipase
Orthologous groupCOG1752
KEGG orthology K07001

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.895 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 10 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.359 (low power) · 2 consensus substitution(s)
low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 49/53 (92%) · mean identity 73.0% · 3/4 closest MTBAP relatives
conserved across the genus (present in 49/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 2/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 41.4%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 18 in the ORF — 0 in the essential state, 0 growth-defect, 18 non-essential, 0 growth-advantage. Saturation 0.944, mean read count 25.4117647059. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Enzyme activity (activity-based protein profiling) active serine hydrolase confirms atlas call

Directly labelled by a fluorophosphonate activity-based probe in live M. tuberculosis: biochemical proof that this protein is a catalytically active serine hydrolase, not merely a predicted fold. This experimentally corroborates the atlas assignment (Patatin-like phospholipase family protein. Pfam: Patatin (PF01734.28).), which was derived independently from structure and orthology.

Source annotationRv2037c Conserved transmembrane protein (cell wall & cell processes)
Probe enrichment20.0× over no-probe control (20 = capped maximum)
Covalent-inhibitor competition9.48× (probe labelling blocked by a serine-hydrolase inhibitor)

experimental (activity-based) confirmation of the atlas serine-hydrolase family assignment; proves the enzyme is catalytically active in live M. tuberculosis. It never changes the verdict here. Source: Li M, Patel HV, ..., Canaan S, Aldridge BB et al., Cell Chem Biol 2021 (PMC8964833; doi:10.1016/j.chembiol.2021.09.002); competitive activity-based protein profiling of FP-reactive serine hydrolases.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection (in vivo) -1.000.04 required

Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 12 of 16 independent MS datasets
Integrated abundance50.7 ppm · rank 1739/3519 (50.6th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length324 aa
Molecular weight34.7 kDa
Theoretical pI5.15
GRAVY0.143 (hydrophobic)
Aliphatic index98.8
Aromaticity0.09
Instability index33.2 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PatatinPF01734.28 1.1e-3311–209 Patatin-like phospholipase

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 84.1

PDB hitprobTM-scoreE-valueDescription
5fya-assembly1_A 1.00 0.79 5.3e-11 sig 5fya-assembly1_A Cubic crystal of the native PlpD
5fya-assembly1_B 1.00 0.74 1.1e-10 sig 5fya-assembly1_B Cubic crystal of the native PlpD
5fqu-assembly1_A 1.00 0.79 6.4e-10 sig 5fqu-assembly1_A Orthorhombic crystal structure of of PlpD (selenomethionine derivative)
5fqu-assembly1_B 1.00 0.78 1.2e-09 sig 5fqu-assembly1_B Orthorhombic crystal structure of of PlpD (selenomethionine derivative)
4akx-assembly1_B 1.00 0.49 8.0e-06 sig 4akx-assembly1_B Structure of the heterodimeric complex ExoU-SpcU from the type III secretion system (T3SS) of Pseudomonas aeruginosa

Foldseek search of the AlphaFold DB model (mean pLDDT 84.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 8

Upstream (5' on genome)Rv2036 (+ strand, 6 bp gap)
Downstream (3' on genome)Rv2038c (- strand, 1 bp gap)
Predicted operon Rv2037c · Rv2038c · Rv2039c · Rv2040c · Rv2041c · Rv2042c · pncA · Rv2044c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) devR (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv2041c (sugar ABC transporter substrate-binding lipoprotein), high confidence from genomic context alone (score 827 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2041c sugar ABC transporter substrate-binding lipoprotein 827 827 ctx neighborhood:774
Rv2039c sugar ABC transporter permease 812 812 ctx neighborhood:807
Rv2038c ugpC sugar ABC transporter ATP-binding protein 807 806 ctx neighborhood:801
Rv2040c sugar ABC transporter permease 785 786 ctx neighborhood:781
Rv2043c pncA pyrazinamidase/nicotinamidase PncA 674 675 ctx neighborhood:664
Rv2042c hyp hypothetical protein 670 670 ctx neighborhood:656
Rv2044c hyp hypothetical protein 555 555 ctx neighborhood:550
Rv0629c recD exonuclease V subunit alpha RecD 514 514 ctx neighborhood:511
Rv0631c recC exonuclease V subunit gamma RecC 513 514 ctx neighborhood:511
Rv0630c recB exonuclease V subunit beta RecB 513 513 ctx neighborhood:511
Rv1063c NTE family protein 426 427 ctx cooccurence:425
Rv2045c lipT carboxylesterase LipT 414 413 ctx neighborhood:406
Rv3600c coaX type III pantothenate kinase 874 74 textmining:870
Rv2225 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase 662 72 textmining:651
Rv2003c hyp hypothetical protein 805 55 textmining:803

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: patatin-like phospholipase family protein
  • Pfam (hmmscan --cut_ga): Patatin PF01734.28 (E=1e-33)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216553.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Patatin (PF01734.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1752
  • Curated reference: UniProt L0TB61 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 84.1)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor Rv2041c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002170|Rv2037c|
MALVSTARVDLVCEGGGVRGIGLVGAVDALADAGYRFPRVAGSSAGAIVASLVAALQTAGEPVTRLAEMMRSIDYPKFLDRNLIGHVPLIGGGLSLLLSDGVYRGAYLEQLLGGLLADLGVHTFGDLRTGEAPEQFAWSLVVTASDLSRRRLVRIPWDLDSYGIHPDDFSVARAVHASSAIPFVFEPVRVRGATWVDGGLLSNFPVALFDRTDAEPRWPTFGIRLSARPGIPPTRPVQGPVSLGIAAIETLVSNQDNAYIDDPCTVRRTIFVPAHDVSPIDFDITAEQREALYQRGFQAGQKFLANWNYADYLADCGGPFTPSL