ugpC Family assigned · medium auto-curated

H37Rv Rv2038c · MTBC0 mtbc0_002171 · 357 aa · 2312336–2313409 (-) · RefSeq NP_216554.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)sugar ABC transporter ATP-binding protein
MTBC0 PGAP re-annotationsn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Revised (this work)Sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC. Pfam: ABC_tran (PF00005.34), OB_MalK (PF17912.8), TOBE_2 (PF08402.17).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53482 TrEMBL · unreviewed · Predicted
UniProt nameTrehalose import ATP-binding protein SugC
Curated functionPart of the ABC transporter complex LpqY-SugA-SugB-SugC, which is highly specific for uptake of trehalose. Involved in the recycling of extracellular trehalose released from trehalose-containing molecules synthesized by M.tuberculosis. Trehalose uptake is essential for virulence. Responsible for energy coupling to the transport system.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
eggNOG descriptionABC transporter
Orthologous groupCOG3842
KEGG orthology K10112
KEGG pathways map02010
KEGG modules M00194, M00196, M00197, M00200, M00201, M00206, M00207, M00491, M00602, M00605, M00606

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.695 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ABC_tranPF00005.34 1.0e-3021–163 ABC transporter
OB_MalKPF17912.8 1.5e-07237–282 MalK OB fold domain
TOBE_2PF08402.17 2.2e-07275–348 TOBE domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2039c (sugar ABC transporter permease), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2039c sugar ABC transporter permease 999 1000 ctx neighborhood:882 cooccurence:769 coexpression:890 experimental:441 database:900 textmining:829
Rv2040c sugar ABC transporter permease 999 1000 ctx neighborhood:801 cooccurence:772 coexpression:878 experimental:458 database:900 textmining:699
Rv2041c sugar ABC transporter substrate-binding lipoprotein 998 992 ctx neighborhood:800 cooccurence:570 coexpression:861 experimental:444 textmining:828
Rv1237 sugB sugar ABC transporter permease SugB 981 979 ctx cooccurence:739 coexpression:441 experimental:858
Rv1236 sugA sugar ABC transporter permease SugA 981 967 ctx cooccurence:710 coexpression:466 experimental:788 textmining:457
Rv2835c ugpA sn-glycerol-3-phosphate ABC transporter permease UgpA 977 933 ctx cooccurence:753 coexpression:479 experimental:458 textmining:679
Rv2316 uspA sugar ABC transporter permease UspA 957 932 ctx cooccurence:767 coexpression:466 experimental:458 textmining:404
Rv2834c ugpE sn-glycerol-3-phosphate ABC transporter permease UgpE 954 929 ctx cooccurence:762 coexpression:443 experimental:441
Rv2317 uspB sugar ABC transporter permease UspB 967 925 ctx cooccurence:764 coexpression:438 experimental:441 textmining:580
Rv1238 sugC sugar ABC transporter ATP-binding protein SugC 906 905 database:900
Rv2037c transmembrane protein 807 806 ctx neighborhood:801
Rv2833c ugpB sn-glycerol-3-phosphate ABC transporter substrate-binding lipoprotein UgpB 919 800 coexpression:478 experimental:469 textmining:613
Rv1235 lpqY trehalose ABC transporter substrate-binding lipoprotein LpqY 817 720 coexpression:466 experimental:469
Rv2042c hyp hypothetical protein 671 672 ctx neighborhood:666
Rv2318 uspC sugar ABC transporter substrate-binding lipoprotein UspC 879 670 coexpression:471 textmining:650

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: sugar ABC transporter ATP-binding protein
  • MTBC0 PGAP product: sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
  • Pfam (hmmscan --cut_ga): ABC_tran PF00005.34 (E=1e-30), OB_MalK PF17912.8 (E=1e-07), TOBE_2 PF08402.17 (E=2e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216554.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ABC_tran (PF00005.34), OB_MalK (PF17912.8), TOBE_2 (PF08402.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3842
  • Curated reference: UniProt O53482 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor Rv2039c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002171|Rv2038c|ugpC
MASVSFEQATRRYPGTDRPALDRLDLIVGDGEFVVLVGPSGCGKTTSLRMVAGLETLDCGRIRIGERDVTEVDPKDRDVAMVFQNYALYPHMTVAQNMGFALKVAKIGKAEIRERVLAAAKLLDLQSYLDRKPKDLSGGQRQRVAMGRAIVRRPQVFLMDEPLSNLDAKLRGQTRNQIAALQRQLGTTTVYVTHDQVEAMTMGDRVAVLSDGVLQQCASPRELYRNPGNVFVAGFIGSPAMNLFRLSIADSTVSLGDWQILLPRAVVGTAAEVIIGVRPEHLELGGAGIEMDVDMVEELGADAYLYGRIVSGGCEMDQSIVARVDGRGPPERGSRVRLCPTPGHLHFFAVDGRRIPG