lppI Family assigned · medium
H37Rv Rv2046 · MTBC0 mtbc0_002179 ·
218 aa ·
2319882–2320538 MTBC0
(+) ·
RefSeq NP_216562.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | lipoprotein LppI |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved lipoprotein LppI; interacts physically and site-specifically with the virulence-associated lipid-transport protein LprG (at the entrance to its lipid-binding pocket), implicating it in outer-membrane lipid assembly/transport. Substrate/precise activity unfixed. |
| Functional category (TubercuList) | cell wall and cell processes |
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (1 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Novel mutations associated with clofazimine resistance in Mycobacterium intracellulare. doi:10.1093/jac/dkaf321 | 2025 |
| A Screen for Protein-Protein Interactions in Live Mycobacteria Reveals a Functional Link between the Virulence-Associated Lipid Transporter LprG and the Mycolyltransferase Antigen 85A. doi:10.1021/acsinfecdis.6b00179 | 2017 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 22% of residues (metapredict) · mean AlphaFold pLDDT 89.2 |
|---|---|
| Disordered regions | 1 IDR(s), longest 48 aa [0-48] |
carries a substantial disordered region (48/218 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
CRISPRi vulnerability
Vulnerability index 0.56 (95% CI -0.71 to 2.38). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2072
· 99.5% identity |
|---|---|
| M. marinum |
MMAR_3021
· 64.2% identity |
| M. smegmatis |
MSMEG_3851
· 41.8% identity |
| M. orygis |
RJtmp_002118
· 99.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O53489
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable lipoprotein LppI |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Preferred name | lppI |
|---|---|
| Orthologous group | 2B0HC |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.728 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacteriaceae
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 3 consensus substitution(s) low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 49/53 (92%) · mean identity 68.4%
· 3/4 closest MTBAP relatives conserved across the genus (present in 49/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 1/13 non-Mycobacterium reference genomes (down to Mycobacteriaceae) · mean identity 52.1% detected in the sister family Mycobacteriaceae (M. abscessus) but not in the broader Corynebacteriales — a Mycobacteriaceae-restricted gene (single-genome rung: interpret with care) |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 10 in the ORF — 0 in the essential state, 0 growth-defect, 10 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 139.4. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 12 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 114.0 ppm · rank 1207/3519 (65.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox) lipoprotein
| Prediction | predicted lipoprotein (lipobox + signal peptide) |
|---|---|
| DeepTMHMM class | SP |
| Lipobox | signal-peptidase-II lipobox; lipidated Cys near position 16 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 218 aa |
|---|---|
| Molecular weight | 22.2 kDa |
| Theoretical pI | 5.2 |
| GRAVY | 0.083 (hydrophobic) |
| Aliphatic index | 76.7 |
| Aromaticity | 0.073 |
| Instability index | 43.1 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | lipT (- strand, 48 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2047c (- strand, 36 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: lipT (carboxylesterase LipT), medium confidence from genomic context alone (score 679 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2045c lipT |
carboxylesterase LipT | 678 | 679 ctx | neighborhood:674 |
Rv2044c hyp |
hypothetical protein | 483 | 482 ctx | neighborhood:480 |
Rv2116 lppK |
lipoprotein LppK | 591 | 44 | textmining:590 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Lipoprotein; site-specific interactor of LprG (lipid transport / outer-membrane biogenesis) (Touchette 2017, PMID 28276676)
- Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216562.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2B0HC - Curated reference: UniProt O53489 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 89.2)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
3 functional partner(s); context anchor
lipT - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide; (myco)bacterial lipobox (Sutcliffe & Harrington 2004, doi:10.1099/mic.0.26804-0)
- Primary literature: Touchette MH, Van Vlack ER, Bai L, Kim J, Cognetta AB 3rd, Previti ML, Backus KM, Martin DW, Cravatt BF, Seeliger JC (2017). A Screen for Protein-Protein Interactions in Live Mycobacteria Reveals a Functional Link between the Virulence-Associated Lipid Transporter LprG and the Mycolyltransferase Antigen 85A ACS Infect Dis 3(5):336-348. doi:10.1021/acsinfecdis.6b00179 PMID:28276676
Ancestral MTBC0 protein sequence
>mtbc0_002179|Rv2046|lppI MRIAALVAVSLLIAGCSREVGGDVGQSQTIAPPAPAPSAAPSTPPAAGAPITTIVSWIEAGHPVDPAAYHVATRDGVTTQLGDDVAFSASSGTVACMTDARHTSGTLACLVRLANPPPRPETAYGEWKGGWVDFDGIHLQVGSARADPGPFVYGNGPELANGDTLSIGDYRCRSYQAGLFCVNYAHQSAVRFASAGIEPFGCLKPAPPPDGVGVAFGC
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for lppI? Email the maintainer — the message is pre-filled with this gene's details.