lppI Family assigned · medium

H37Rv Rv2046 · MTBC0 mtbc0_002179 · 218 aa · 2319882–2320538 (+) · RefSeq NP_216562.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LppI
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved lipoprotein LppI; interacts physically and site-specifically with the virulence-associated lipid-transport protein LprG (at the entrance to its lipid-binding pocket), implicating it in outer-membrane lipid assembly/transport. Substrate/precise activity unfixed.

Curated reference (UniProt)

UniProt O53489 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable lipoprotein LppI

Functional vocabulary (eggNOG-mapper, orthology transfer)

Preferred namelppI
Orthologous group2B0HC

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.728 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lipT (carboxylesterase LipT), medium confidence from genomic context alone (score 679 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2045c lipT carboxylesterase LipT 678 679 ctx neighborhood:674
Rv2044c hyp hypothetical protein 483 482 ctx neighborhood:480
Rv2116 lppK lipoprotein LppK 591 44 textmining:590

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Lipoprotein; site-specific interactor of LprG (lipid transport / outer-membrane biogenesis) (Touchette 2017, PMID 28276676)
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216562.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2B0HC
  • Curated reference: UniProt O53489 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 3 functional partner(s); context anchor lipT
  • Primary literature: Touchette MH, Van Vlack ER, Bai L, Kim J, Cognetta AB 3rd, Previti ML, Backus KM, Martin DW, Cravatt BF, Seeliger JC (2017). A Screen for Protein-Protein Interactions in Live Mycobacteria Reveals a Functional Link between the Virulence-Associated Lipid Transporter LprG and the Mycolyltransferase Antigen 85A ACS Infect Dis 3(5):336-348. doi:10.1021/acsinfecdis.6b00179 PMID:28276676

Ancestral MTBC0 protein sequence

>mtbc0_002179|Rv2046|lppI
MRIAALVAVSLLIAGCSREVGGDVGQSQTIAPPAPAPSAAPSTPPAAGAPITTIVSWIEAGHPVDPAAYHVATRDGVTTQLGDDVAFSASSGTVACMTDARHTSGTLACLVRLANPPPRPETAYGEWKGGWVDFDGIHLQVGSARADPGPFVYGNGPELANGDTLSIGDYRCRSYQAGLFCVNYAHQSAVRFASAGIEPFGCLKPAPPPDGVGVAFGC