hspX Resolved · high auto-curated
H37Rv Rv2031c · MTBC0 mtbc0_002164 ·
144 aa ·
2307111–2307545 MTBC0
(-) ·
RefSeq NP_216547.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | alpha-crystallin |
|---|---|
| MTBC0 PGAP re-annotation | alpha-crystallin HspX |
| Revised (this work) | Alpha-crystallin HspX. Pfam: HSP20 (PF00011.28), ArsA_HSP20 (PF17886.8). |
| Functional category (TubercuList) | virulence, detoxification, adaptation |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 251 publications
251 TB publications mention this gene. 251 publication(s) discuss this gene (237 in a M. tuberculosis context, 13 in other mycobacteria — M. smegmatis (10), M. marinum (1)).
| Publication | Date |
|---|---|
| Multifaceted DosR proteins of Mycobacterium tuberculosis: emerging roles for tuberculosis control. doi:10.1007/s00203-026-04983-7 | 2026 |
| A versatile plasmid platform for auxotrophic complementation in attenuated Mycobacterium bovis BCG. doi:10.1007/s11033-026-11830-x | 2026 |
| Comparison of long-term and short-term immunogenicity based on two different types of tuberculosis subunit vaccines. doi:10.1007/s00203-026-04733-9 | 2026 |
| Optimized Mass Spectrometry to Uncover M. tuberculosis Biomarkers in Extracellular Vesicles from Asymptomatic Tuberculosis Patients. doi:10.1093/infdis/jiag086 | 2026 |
| The regulation characterization of novel transcription regulator JTY_2262 in Mycobacterium bovis BCG. doi:10.1016/j.biochi.2026.01.013 | 2026 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
DevR-1 (devR).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 1.92 (95% CI -1.08 to 6.59). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Stress protein induced by anoxia. Has a proposed role in maintenance of long-term viability during latent, asymptomatic infections, and a proposed role in replication during initial infection. Regulated by the two component regulatory system DEVR|Rv3133c/DEVS|Rv3132c, in response to a hypoxic signal. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2057c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_3484
· 72.3% identity |
| M. smegmatis |
MSMEG_3932
· 60.8% identity |
| M. orygis |
RJtmp_002103
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WMK1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Alpha-crystallin |
| Curated function | Acts as a chaperone, as it has a significant ability to suppress the thermal denaturation of alcohol dehydrogenase. Cells overexpressing this gene grow more slowly than wild-type cells, and are less susceptible to autolysis following saturation of the culture in vitro, suggesting this protein may slow down the growth rate of M.tuberculosis in culture and by extension during macrophage infection. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
O Post-translational modification, protein turnover, chaperones
|
|---|---|
| Preferred name | hspX |
| eggNOG description | Belongs to the small heat shock protein (HSP20) family |
| Orthologous group | COG0071 |
| KEGG orthology |
K13993
|
| KEGG pathways |
map04141
|
| Gene Ontology (89) |
GO:0001666, GO:0003674, GO:0005488, GO:0005515, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006457 +77 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.321 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 61.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 7/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 37.2% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 8 in the ORF — 0 in the essential state, 0 growth-defect, 8 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 97.25. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 8 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 8 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB)
| Condition | log2FC | q | Effect |
|---|---|---|---|
| altered fitness under 6 weeks hypoxia (stress) | -5.38 | 0.0 | required |
| altered fitness under 3 weeks hypoxia (stress) | -1.72 | 0.0 | required |
Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 34979.0 ppm · rank 2/3519 (100.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 144 aa |
|---|---|
| Molecular weight | 16.2 kDa |
| Theoretical pI | 5.0 |
| GRAVY | -0.52 (hydrophilic) |
| Aliphatic index | 72.4 |
| Aromaticity | 0.083 |
| Instability index | 40.6 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
HSP20 | PF00011.28 | 1.4e-24 | 45–140 | Hsp20/alpha crystallin family |
ArsA_HSP20 | PF17886.8 | 1.8e-06 | 48–125 | HSP20-like domain found in ArsA |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 80.7
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5zul-assembly1_A-2 |
1.00 | 0.88 | 7.1e-08 sig | 5zul-assembly1_A-2 Small heat shock protein from Mycobacterium marinum M : Form-3 |
5j7n-assembly1_A |
1.00 | 0.76 | 2.5e-08 sig | 5j7n-assembly1_A Crystal structure of a small heat-shock protein from Xylella fastidiosa reveals a distinct high order structure |
6l6m-assembly1_A |
1.00 | 0.79 | 2.3e-08 sig | 6l6m-assembly1_A HSP18.5 from E. histolytica |
3w1z-assembly1_D |
1.00 | 0.77 | 3.3e-08 sig | 3w1z-assembly1_D Heat shock protein 16.0 from Schizosaccharomyces pombe |
5zul-assembly1_E-2 |
1.00 | 0.85 | 5.7e-08 sig | 5zul-assembly1_E-2 Small heat shock protein from Mycobacterium marinum M : Form-3 |
Foldseek search of the AlphaFold DB model (mean pLDDT 80.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | Rv2030c (- strand, 11 bp gap) |
|---|---|
| Downstream (3' on genome) | acg (+ strand, 196 bp gap) |
| Predicted operon |
Rv2028c · pfkB · Rv2030c · hspX
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
Rv2250c (activates) · devR (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: acg (NAD(P)H nitroreductase), high confidence from genomic context alone (score 932 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2030c hyp |
hypothetical protein | 980 | 966 ctx | neighborhood:792 coexpression:804 textmining:452 |
Rv2032 acg |
NAD(P)H nitroreductase | 967 | 932 ctx | neighborhood:531 coexpression:860 textmining:548 |
Rv1738 hyp |
hypothetical protein | 963 | 906 | coexpression:860 textmining:630 |
Rv1996 |
universal stress protein | 916 | 893 | coexpression:864 |
Rv3134c |
universal stress protein | 941 | 871 | coexpression:843 textmining:564 |
Rv3131 |
NAD(P)H nitroreductase | 918 | 864 | coexpression:860 textmining:429 |
Rv0079 hyp |
hypothetical protein | 910 | 864 | coexpression:862 |
Rv2626c hrp1 |
hypoxic response protein | 950 | 863 | coexpression:859 textmining:654 |
Rv3130c tgs1 |
diacyglycerol O-acyltransferase | 942 | 862 | coexpression:861 textmining:602 |
Rv3127 hyp |
hypothetical protein | 909 | 861 | coexpression:860 |
Rv2007c fdxA |
ferredoxin | 947 | 860 | coexpression:860 textmining:640 |
Rv2623 TB31.7 |
universal stress protein | 971 | 856 | coexpression:827 textmining:812 |
Rv1733c |
transmembrane protein | 936 | 837 | coexpression:804 textmining:625 |
Rv0080 hyp |
hypothetical protein | 872 | 833 | coexpression:829 |
Rv2627c hyp |
hypothetical protein | 810 | 810 | coexpression:805 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: alpha-crystallin
- MTBC0 PGAP product: alpha-crystallin HspX
- Pfam (hmmscan --cut_ga): HSP20 PF00011.28 (E=1e-24), ArsA_HSP20 PF17886.8 (E=2e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216547.1)
- Domains: Pfam-A via hmmscan --cut_ga — HSP20 (PF00011.28), ArsA_HSP20 (PF17886.8)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0071 - Curated reference: UniProt P9WMK1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 80.7)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
89 functional partner(s); context anchor
acg - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002164|Rv2031c|hspX MATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for hspX? Email the maintainer — the message is pre-filled with this gene's details.