Rv2035 Family assigned · medium auto-curated
H37Rv Rv2035 · MTBC0 mtbc0_002168 ·
162 aa · 2310227–2310715 (+) ·
RefSeq NP_216551.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | SRPBCC family protein |
| Revised (this work) | SRPBCC family protein. Pfam: AHSA1 (PF08327.18). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53479
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Activator of Hsp90 ATPase homolog 1-like protein |
| Orthologous group | COG3832 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.801 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
AHSA1 | PF08327.18 | 9.8e-08 | 16–151 | Activator of Hsp90 ATPase homolog 1-like protein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv2034 (ArsR family HTH-type transcriptional repressor), high confidence from genomic context alone (score 942 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2036 hyp |
hypothetical protein | 992 | 983 ctx | neighborhood:882 coexpression:845 textmining:546 |
Rv2034 |
ArsR family HTH-type transcriptional repressor | 970 | 942 ctx | neighborhood:882 cooccurence:493 textmining:510 |
Rv2033c hyp |
hypothetical protein | 628 | 549 ctx | neighborhood:546 |
Rv3351c hyp |
hypothetical protein | 537 | 538 ctx | cooccurence:533 |
Rv3071 hyp |
hypothetical protein | 465 | 465 ctx | cooccurence:462 |
Rv3295 |
TetR family transcriptional regulator | 417 | 417 ctx | cooccurence:417 |
Rv0063 |
oxidoreductase | 483 | 336 | |
Rv1546 hyp |
hypothetical protein | 510 | 172 | textmining:433 |
Rv0549c vapC3 |
ribonuclease VapC3 | 404 | 158 | |
Rv3189 hyp |
hypothetical protein | 661 | 64 | textmining:653 |
Rv3188 hyp |
hypothetical protein | 659 | 64 | textmining:651 |
Rv0837c hyp |
hypothetical protein | 440 | 59 | textmining:430 |
Rv0918 hyp |
hypothetical protein | 646 | 55 | textmining:641 |
Rv1989c mbcT hyp |
hypothetical protein | 546 | 55 | textmining:540 |
Rv2021c higA2 |
transcriptional regulator | 440 | 50 | textmining:435 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: SRPBCC family protein
- Pfam (hmmscan --cut_ga): AHSA1 PF08327.18 (E=1e-07)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216551.1)
- Domains: Pfam-A via hmmscan --cut_ga — AHSA1 (PF08327.18)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3832 - Curated reference: UniProt O53479 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
22 functional partner(s); context anchor
Rv2034 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002168|Rv2035| MTRPRTDAIHHHVVVNAPIERAFAVFTTRFGDFKPREHNLLAIPITETVFECHAGGHIYDRGVDGSVCKWARVLVYEPPSRVLFTWDIGPTWRPETDLAKTSEVEVRFTAQSAETTRVDLEHRHLDRHGPGWESVADGVDSEAGWPLYLRRYTDLLCIQVQP