Rv2035 Family assigned · medium auto-curated

H37Rv Rv2035 · MTBC0 mtbc0_002168 · 162 aa · 2310227–2310715 (+) · RefSeq NP_216551.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationSRPBCC family protein
Revised (this work)SRPBCC family protein. Pfam: AHSA1 (PF08327.18).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53479 TrEMBL · unreviewed · Evidence at protein level
UniProt nameActivator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionActivator of Hsp90 ATPase homolog 1-like protein
Orthologous groupCOG3832

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.801 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AHSA1PF08327.18 9.8e-0816–151 Activator of Hsp90 ATPase homolog 1-like protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2034 (ArsR family HTH-type transcriptional repressor), high confidence from genomic context alone (score 942 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2036 hyp hypothetical protein 992 983 ctx neighborhood:882 coexpression:845 textmining:546
Rv2034 ArsR family HTH-type transcriptional repressor 970 942 ctx neighborhood:882 cooccurence:493 textmining:510
Rv2033c hyp hypothetical protein 628 549 ctx neighborhood:546
Rv3351c hyp hypothetical protein 537 538 ctx cooccurence:533
Rv3071 hyp hypothetical protein 465 465 ctx cooccurence:462
Rv3295 TetR family transcriptional regulator 417 417 ctx cooccurence:417
Rv0063 oxidoreductase 483 336
Rv1546 hyp hypothetical protein 510 172 textmining:433
Rv0549c vapC3 ribonuclease VapC3 404 158
Rv3189 hyp hypothetical protein 661 64 textmining:653
Rv3188 hyp hypothetical protein 659 64 textmining:651
Rv0837c hyp hypothetical protein 440 59 textmining:430
Rv0918 hyp hypothetical protein 646 55 textmining:641
Rv1989c mbcT hyp hypothetical protein 546 55 textmining:540
Rv2021c higA2 transcriptional regulator 440 50 textmining:435

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: SRPBCC family protein
  • Pfam (hmmscan --cut_ga): AHSA1 PF08327.18 (E=1e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216551.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AHSA1 (PF08327.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3832
  • Curated reference: UniProt O53479 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor Rv2034
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002168|Rv2035|
MTRPRTDAIHHHVVVNAPIERAFAVFTTRFGDFKPREHNLLAIPITETVFECHAGGHIYDRGVDGSVCKWARVLVYEPPSRVLFTWDIGPTWRPETDLAKTSEVEVRFTAQSAETTRVDLEHRHLDRHGPGWESVADGVDSEAGWPLYLRRYTDLLCIQVQP