Rv2039c Family assigned · medium auto-curated

H37Rv Rv2039c · MTBC0 mtbc0_002172 · 280 aa · 2313412–2314254 (-) · RefSeq NP_216555.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)sugar ABC transporter permease
MTBC0 PGAP re-annotationcarbohydrate ABC transporter permease
Revised (this work)Carbohydrate ABC transporter permease. Pfam: BPD_transp_1 (PF00528.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53483 TrEMBL · unreviewed · Inferred from homology
UniProt nameProbable sugar-transport integral membrane protein ABC transporter

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
eggNOG descriptionABC transporter
Orthologous groupCOG0395
KEGG orthology K02026
KEGG modules M00207

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.346 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
BPD_transp_1PF00528.28 7.5e-1995–273 Binding-protein-dependent transport system inner membrane component

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ugpC (sugar ABC transporter ATP-binding protein), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2038c ugpC sugar ABC transporter ATP-binding protein 999 1000 ctx neighborhood:882 cooccurence:769 coexpression:890 experimental:441 database:900 textmining:829
Rv2040c sugar ABC transporter permease 999 1000 ctx neighborhood:801 cooccurence:774 coexpression:906 experimental:412 database:900 textmining:831
Rv2041c sugar ABC transporter substrate-binding lipoprotein 999 998 ctx neighborhood:881 cooccurence:759 coexpression:872 experimental:412 textmining:777
Rv2835c ugpA sn-glycerol-3-phosphate ABC transporter permease UgpA 979 932 ctx cooccurence:774 coexpression:493 experimental:412 textmining:713
Rv2832c ugpC sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC 978 931 ctx cooccurence:769 coexpression:443 experimental:441 textmining:702
Rv2316 uspA sugar ABC transporter permease UspA 956 930 ctx cooccurence:774 coexpression:480 experimental:412 textmining:403
Rv1236 sugA sugar ABC transporter permease SugA 956 926 ctx cooccurence:765 coexpression:481 experimental:412 textmining:439
Rv1238 sugC sugar ABC transporter ATP-binding protein SugC 948 924 ctx cooccurence:768 coexpression:439 experimental:441
Rv2833c ugpB sn-glycerol-3-phosphate ABC transporter substrate-binding lipoprotein UgpB 931 851 ctx cooccurence:551 coexpression:451 experimental:412 textmining:561
Rv2037c transmembrane protein 812 812 ctx neighborhood:807
Rv2318 uspC sugar ABC transporter substrate-binding lipoprotein UspC 924 786 coexpression:449 experimental:412 textmining:664
Rv1235 lpqY trehalose ABC transporter substrate-binding lipoprotein LpqY 823 750 coexpression:446 experimental:412
Rv2042c hyp hypothetical protein 680 681 ctx neighborhood:666
Rv2043c pncA pyrazinamidase/nicotinamidase PncA 669 670 ctx neighborhood:666
Rv2044c hyp hypothetical protein 576 576 ctx neighborhood:558

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: sugar ABC transporter permease
  • MTBC0 PGAP product: carbohydrate ABC transporter permease
  • Pfam (hmmscan --cut_ga): BPD_transp_1 PF00528.28 (E=7e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216555.1)
  • Domains: Pfam-A via hmmscan --cut_ga — BPD_transp_1 (PF00528.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0395
  • Curated reference: UniProt O53483 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor ugpC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002172|Rv2039c|
MGWADRIVHRHFIRGLALYAGLIGIAWCALFPIIWALSGSLKADGEVTEPTLFPSHPQWSNYREVFALMPFWRMFFNTVLYAGCVTAGQVFFCSLAGYAFARLQFRGRDTLFVLYLSTLMVPLTVTVIPQFILMRIVGWVDTPWAMIVPGLFGSAFGTYLMRQFFRTLPTDLEEAAILDGCSPWQIYWRILLPHSRPAVLVLGVLTWVNVWNDFLWPLLMIQRNSLATLTLGLVRLRGEYVARWPVLMAASMLMLVPLVILYAVAQRSFVRGIAVTGLGG