Rv2570 Family assigned · medium auto-curated

H37Rv Rv2570 · MTBC0 mtbc0_002737 · 129 aa · 2918056–2918445 (+) · RefSeq NP_217086.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationMmcQ/YjbR family DNA-binding protein
Revised (this work)MmcQ/YjbR family DNA-binding protein. Pfam: YjbR (PF04237.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WL91 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv2570

UniProt still lists this protein as Uncharacterized protein Rv2570; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionCatalyzes the transfer of a formyl group from 10- formyltetrahydrofolate to 5-phospho-ribosyl-glycinamide (GAR), producing 5-phospho-ribosyl-N-formylglycinamide (FGAR) and tetrahydrofolate
Orthologous groupCOG3801

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.435 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 4 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 3.30% of strains (4790) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
YjbRPF04237.19 7.4e-0814–113 YjbR

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0541c (integral membrane protein), medium confidence from genomic context alone (score 440 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2569c hyp hypothetical protein 656 656 ctx neighborhood:655
Rv2568c hyp hypothetical protein 655 655 ctx neighborhood:655
Rv2036 hyp hypothetical protein 561 562 ctx cooccurence:559
Rv2828A hyp hypothetical protein 478 478 ctx cooccurence:478
Rv1868 hyp hypothetical protein 451 452 ctx cooccurence:444
Rv0541c integral membrane protein 440 440 ctx cooccurence:440
Rv1006 hyp hypothetical protein 413 413 ctx cooccurence:413

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: MmcQ/YjbR family DNA-binding protein
  • Pfam (hmmscan --cut_ga): YjbR PF04237.19 (E=7e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217086.1)
  • Domains: Pfam-A via hmmscan --cut_ga — YjbR (PF04237.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3801
  • Curated reference: UniProt P9WL91 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 7 functional partner(s); context anchor Rv0541c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002737|Rv2570|
MATWDDVARIVGGLPLTAEQAPHDWRVGRKLLAWERPLRKSDREALTRAGSEPPSGDIVGVRVSDEGVKFALIADEPGVYFTTPHFDGYPAVLVRLAEIEVRDLEELITEAWLMQAPKQLVQAFLANSG