Rv2033c Still unknown · low

H37Rv Rv2033c · MTBC0 mtbc0_002166 · 280 aa · 2308853–2309695 (-) · RefSeq NP_216549.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF3097 domain-containing protein
Revised (this work)DUF3097; Foldseek best hit (OLD protein, TM 0.49) not conclusive. Function unknown.

Curated reference (UniProt)

UniProt O53477 TrEMBL · unreviewed · Evidence at protein level
UniProt nameDUF3097 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF3097)
Orthologous groupCOG0613

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3097_NPF22845.3 2.8e-2522–80 DUF3097, N-terminal domain
DUF3097_CPF11296.15 2.1e-76109–275 DUF3097, C-terminal domain

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 95.5 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
6nk8-assembly1_A-2 1.00 0.49 6.6e-04 sig 6nk8-assembly1_A-2 C-terminal region of the Burkholderia pseudomallei OLD protein
6nk8-assembly1_B-2 0.99 0.44 1.7e-03 sig 6nk8-assembly1_B-2 C-terminal region of the Burkholderia pseudomallei OLD protein
6zye-assembly1_E 0.97 0.77 2.4e-01 6zye-assembly1_E YnaI in an open-like conformation
6cer-assembly1_D 0.89 0.44 1.1e-02 6cer-assembly1_D Human pyruvate dehydrogenase complex E1 component V138M mutation
3ezx-assembly1_A 0.84 0.50 3.4e-02 3ezx-assembly1_A Structure of Methanosarcina barkeri monomethylamine corrinoid protein
6urt-assembly1_G 0.77 0.76 9.5e-01 6urt-assembly1_G Extended Sensor Paddles with Bound Lipids Revealed in Mechanosensitive Channel YnaI
5y4o-assembly1_A 0.75 0.74 1.0e+00 5y4o-assembly1_A Cryo-EM structure of MscS channel, YnaI
2coy-assembly1_A 0.57 0.48 3.3e-01 2coy-assembly1_A Solution structure of the CAP-Gly domain in human Dynactin 1

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2034 (ArsR family HTH-type transcriptional repressor), medium confidence from genomic context alone (score 548 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2917 hyp hypothetical protein 754 755 ctx cooccurence:752
Rv2256c hyp hypothetical protein 704 705 ctx cooccurence:702
Rv2035 hyp hypothetical protein 628 549 ctx neighborhood:546
Rv2036 hyp hypothetical protein 769 548 ctx neighborhood:546 textmining:511
Rv2034 ArsR family HTH-type transcriptional repressor 606 548 ctx neighborhood:546
Rv3258c hyp hypothetical protein 528 528 ctx cooccurence:505
Rv1321 nucS endonuclease NucS 497 498 ctx cooccurence:495
Rv2680 hyp hypothetical protein 474 475 ctx cooccurence:467
Rv3260c whiB2 transcriptional regulator WhiB2 472 473 ctx cooccurence:465
Rv1301 threonylcarbamoyl-AMP synthase 440 440
Rv1830 HTH-type transcriptional regulator 431 432 ctx cooccurence:427
Rv1087A Rv1087A, len: 106 aa (fragment). Conserved hypothetical protein, highly similar to C-terminus of near ORF O53434|YA86_MYCTU|Rv1086|MT1118|MT 428 428 ctx cooccurence:408
Rv2146c transmembrane protein 426 426 ctx cooccurence:424
Rv2711 ideR iron-dependent repressor and activator IdeR 422 423
Rv2745c clgR transcriptional regulator ClgR 414 415

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: DUF3097 domain-containing protein
  • Pfam: DUF3097_N PF22845.3, DUF3097_C PF11296.15
  • Foldseek best: 6nk8-assembly1_A-2 C-terminal region of the Burkholderia pseudomallei OLD protei (prob 1.00, E=7e-04, TM=0.49)
  • (structure-only promotion reviewed by hand, 2026-06-01)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216549.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3097_N (PF22845.3), DUF3097_C (PF11296.15)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0613
  • Curated reference: UniProt O53477 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 95.5, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 25 functional partner(s); context anchor Rv2034
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002166|Rv2033c|
MLDRYGTDVLAAGGRRRPRSVEHPVELGMVVEDAETGYVGAVVRVEYGRIDLEDRYGKTRGFPLGPGYLLDGLPVILTAPRCAAAAGPRRTASGSVAVPGARARVARASRIYVEGRHDAELIAAVWGADLRIEGVVVEHLGGVDDLVEIVAKFRPGPRRRLGVLVDHLVAGSKEARIAEVVRRGPGGSDTLVVGHPYVDIWQAVKPQRVGLAAWPRVPRHIEWKHGVCDALGWPHADQADIAAAWRRIRSQVRDWTDLEPALIGRVEELIDFVTQPAGDE