Rv2033c Family assigned · medium

H37Rv Rv2033c · MTBC0 mtbc0_002166 · 280 aa · 2308853–2309695 MTBC0 (-) · RefSeq NP_216549.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv2025c (Rv2025c) — family_assigned: cation diffusion facilitator family transporter Rv2025c Rv2026c (Rv2026c) — requalified: universal stress protein Rv2026c dosT (Rv2027c) — requalified: two-component system sensor histidine kinase DosT dosT Rv2028c (Rv2028c) — requalified: universal stress protein Rv2028c pfkB (Rv2029c) — family_assigned: 1-phosphofructokinase family hexose kinase pfkB Rv2030c (Rv2030c) — family_assigned: erythromycin esterase family protein Rv2030c hspX (Rv2031c) — requalified: alpha-crystallin HspX acg (Rv2032) — family_assigned: FMN-binding protein Acg acg Rv2033c (Rv2033c) — family_assigned: DUF3097 domain-containing protein Rv2033c Rv2034 (Rv2034) — family_assigned: metalloregulator ArsR/SmtB family transcription factor Rv2035 (Rv2035) — family_assigned: SRPBCC family protein Rv2036 (Rv2036) — family_assigned: maleylpyruvate isomerase family mycothiol-dependent enzyme Rv2037c (Rv2037c) — family_assigned: patatin-like phospholipase family protein Rv2037c ugpC (Rv2038c) — family_assigned: sn-glycerol-3-phosphate ABC transporter ATP-binding protein ugpC Rv2039c (Rv2039c) — family_assigned: carbohydrate ABC transporter permease Rv2039c Rv2040c (Rv2040c) — family_assigned: sugar ABC transporter permease Rv2040c Rv2041c (Rv2041c) — family_assigned: sugar ABC transporter substrate-binding protein Rv2041c Rv2042c (Rv2042c) — family_assigned: ketosteroid isomerase family protein pncA (Rv2043c) — requalified: pyrazinamidase PncA lppI (Rv2046) — family_assigned: hypothetical protein Rv2047c (Rv2047c) — family_assigned: sugar epimerase family protein 2 300 kb 2 304 kb 2 308 kb 2 312 kb 2 316 kb 2 320 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF3097 domain-containing protein
Revised (this work)5'-3' exoribonuclease / diribonuclease of the TrpH/YciV (RNase AM) family, a metallophosphoesterase-fold RNase (eggNOG COG0613). Named nuclease family; exact in-vivo RNA substrate undetermined.
Functional category (TubercuList)conserved hypotheticals

In the literature (TB corpus sweep) never studied

No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.

A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): Rv1828/SigH (Rv1828 or sigH).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index -0.04 (95% CI -0.77 to 0.96). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2059c · 99.6% identity
M. marinum MMAR_3007 · 85.5% identity
M. smegmatis MSMEG_3020 · 76.7% identity
M. orygis RJtmp_002105 · 99.6% identity
M. abscessus MAB_2854c · 71.4% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O53477 TrEMBL · unreviewed · Evidence at protein level
UniProt nameDUF3097 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF3097)
Orthologous groupCOG0613

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 49/53 (92%) · mean identity 80.9% · 3/4 closest MTBAP relatives
conserved across the genus (present in 49/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 10/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 52.7%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 12 in the ORF — 0 in the essential state, 0 growth-defect, 12 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 80.3333333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 9 of 16 independent MS datasets
Integrated abundance3.57 ppm · rank 3048/3519 (13.4th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length280 aa
Molecular weight30.5 kDa
Theoretical pI7.11
GRAVY-0.145 (hydrophilic)
Aliphatic index98.2
Aromaticity0.061
Instability index36.6 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3097_NPF22845.3 2.8e-2522–80 DUF3097, N-terminal domain
DUF3097_CPF11296.15 2.1e-76109–275 DUF3097, C-terminal domain

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 95.5 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
6nk8-assembly1_A-2 1.00 0.49 6.6e-04 sig 6nk8-assembly1_A-2 C-terminal region of the Burkholderia pseudomallei OLD protein
6nk8-assembly1_B-2 0.99 0.44 1.7e-03 sig 6nk8-assembly1_B-2 C-terminal region of the Burkholderia pseudomallei OLD protein
6zye-assembly1_E 0.97 0.77 2.4e-01 6zye-assembly1_E YnaI in an open-like conformation
6cer-assembly1_D 0.89 0.44 1.1e-02 6cer-assembly1_D Human pyruvate dehydrogenase complex E1 component V138M mutation
3ezx-assembly1_A 0.84 0.50 3.4e-02 3ezx-assembly1_A Structure of Methanosarcina barkeri monomethylamine corrinoid protein
6urt-assembly1_G 0.77 0.76 9.5e-01 6urt-assembly1_G Extended Sensor Paddles with Bound Lipids Revealed in Mechanosensitive Channel YnaI
5y4o-assembly1_A 0.75 0.74 1.0e+00 5y4o-assembly1_A Cryo-EM structure of MscS channel, YnaI
2coy-assembly1_A 0.57 0.48 3.3e-01 2coy-assembly1_A Solution structure of the CAP-Gly domain in human Dynactin 1

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 90.0

PDB hitprobTM-scoreE-valueDescription
6nk8-assembly1_A-2 0.99 0.47 1.4e-03 sig 6nk8-assembly1_A-2 C-terminal region of the Burkholderia pseudomallei OLD protein
6nk8-assembly1_B-2 0.99 0.44 8.8e-04 sig 6nk8-assembly1_B-2 C-terminal region of the Burkholderia pseudomallei OLD protein

Foldseek search of the AlphaFold DB model (mean pLDDT 90.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)acg (+ strand, 115 bp gap)
Downstream (3' on genome)Rv2034 (+ strand, 211 bp gap)

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv2034 (ArsR family HTH-type transcriptional repressor), medium confidence from genomic context alone (score 548 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2917 hyp hypothetical protein 754 755 ctx cooccurence:752
Rv2256c hyp hypothetical protein 704 705 ctx cooccurence:702
Rv2035 hyp hypothetical protein 628 549 ctx neighborhood:546
Rv2036 hyp hypothetical protein 769 548 ctx neighborhood:546 textmining:511
Rv2034 ArsR family HTH-type transcriptional repressor 606 548 ctx neighborhood:546
Rv3258c hyp hypothetical protein 528 528 ctx cooccurence:505
Rv1321 nucS endonuclease NucS 497 498 ctx cooccurence:495
Rv2680 hyp hypothetical protein 474 475 ctx cooccurence:467
Rv3260c whiB2 transcriptional regulator WhiB2 472 473 ctx cooccurence:465
Rv1301 threonylcarbamoyl-AMP synthase 440 440
Rv1830 HTH-type transcriptional regulator 431 432 ctx cooccurence:427
Rv1087A Rv1087A, len: 106 aa (fragment). Conserved hypothetical protein, highly similar to C-terminus of near ORF O53434|YA86_MYCTU|Rv1086|MT1118|MT 428 428 ctx cooccurence:408
Rv2146c transmembrane protein 426 426 ctx cooccurence:424
Rv2711 ideR iron-dependent repressor and activator IdeR 422 423
Rv2745c clgR transcriptional regulator ClgR 414 415

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • eggNOG ortholog COG0613 (COG category S), e-value 3.89e-206
  • NCBI COG name for COG0613: 5'-3' exoribonuclease/diribonuclease TrpH/YciV (RNase AM)
  • COG-number rescue: the eggNOG og is a NAMED COG (NCBI COG database) whose function the eggNOG description field (a DUF) had masked; under-propagated by both the auto-curation and the description-based phase18. Family-level orthology, not a substrate demonstrated in M. tuberculosis.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216549.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3097_N (PF22845.3), DUF3097_C (PF11296.15)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0613
  • Curated reference: UniProt O53477 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 95.5, very high)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 90.0)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 25 functional partner(s); context anchor Rv2034
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002166|Rv2033c|
MLDRYGTDVLAAGGRRRPRSVEHPVELGMVVEDAETGYVGAVVRVEYGRIDLEDRYGKTRGFPLGPGYLLDGLPVILTAPRCAAAAGPRRTASGSVAVPGARARVARASRIYVEGRHDAELIAAVWGADLRIEGVVVEHLGGVDDLVEIVAKFRPGPRRRLGVLVDHLVAGSKEARIAEVVRRGPGGSDTLVVGHPYVDIWQAVKPQRVGLAAWPRVPRHIEWKHGVCDALGWPHADQADIAAAWRRIRSQVRDWTDLEPALIGRVEELIDFVTQPAGDE