dprE2 Resolved · high auto-curated

H37Rv Rv3791 · MTBC0 - · 254 aa · 4237165–4237929 (+) · RefSeq NP_218308.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)decaprenylphosphoryl-D-2-keto erythropentose reductase
MTBC0 PGAP re-annotation
Revised (this work)Decaprenylphosphoryl-D-2-keto erythropentose reductase. Pfam: adh_short (PF00106.32), KR (PF08659.17), adh_short_C2 (PF13561.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WGS9 SwissProt · reviewed · Evidence at protein level
UniProt nameDecaprenylphosphoryl-2-keto-beta-D-erythro-pentose reductase
EC (curated) EC 1.1.1.333
Curated functionComponent of the DprE1-DprE2 complex that catalyzes the 2-step epimerization of decaprenyl-phospho-ribose (DPR) to decaprenyl-phospho-arabinose (DPA), a key precursor that serves as the arabinose donor required for the synthesis of cell-wall arabinans. DprE1 catalyzes the first step of epimerization, namely FAD-dependent oxidation of the C2' hydroxyl of DPR to yield the keto intermediate decaprenyl-phospho-2'-keto-D-arabinose (DPX). The intermediate DPX is then transferred to DprE2 subunit of the epimerase complex, most probably through a 'substrate channel' at the interface of DprE1-DprE2 com.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Q Secondary metabolites biosynthesis, transport and catabolism
Preferred namedprE2
eggNOG descriptionDehydrogenase
Orthologous groupCOG1028
EC number EC 1.1.1.333
KEGG orthology K16652
Gene Ontology (39) GO:0000271, GO:0005575, GO:0005623, GO:0005886, GO:0005975, GO:0005976, GO:0008150, GO:0008152, GO:0009058, GO:0009059, GO:0009987, GO:0010383 +27 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.683 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
adh_shortPF00106.32 8.0e-2810–203 short chain dehydrogenase
KRPF08659.17 9.6e-0611–188 KR domain
adh_short_C2PF13561.13 3.5e-1920–205 Enoyl-(Acyl carrier protein) reductase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: dprE1 (decaprenylphosphoryl-beta-D-ribose oxidase), high confidence from genomic context alone (score 988 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3790 dprE1 decaprenylphosphoryl-beta-D-ribose oxidase 999 988 ctx neighborhood:881 cooccurence:774 database:500 textmining:947
Rv3789 GtrA family protein 966 957 ctx neighborhood:823 cooccurence:764
Rv3793 embC arabinosyltransferase C 961 937 ctx neighborhood:881 cooccurence:485 textmining:405
Rv3792 aftA arabinofuranosyltransferase 957 905 ctx neighborhood:881 textmining:573
Rv3794 embA arabinosyltransferase A 935 896 ctx neighborhood:628 cooccurence:469 database:500 textmining:405
Rv3795 embB arabinosyltransferase B 913 887 ctx neighborhood:580 cooccurence:493 database:500
Rv3806c ubiA decaprenyl-phosphate phosphoribosyltransferase 896 788 ctx cooccurence:773 textmining:531
Rv3788 hyp hypothetical protein 735 736 ctx neighborhood:732
Rv2036 hyp hypothetical protein 587 587 ctx neighborhood:516
Rv3796 hyp hypothetical protein 439 439 ctx neighborhood:434
Rv3805c aftB terminal beta-(1->2)-arabinofuranosyltransferase 473 358
Rv3807c decaprenylphosphoryl-5-phosphoribose phosphatase 800 304 textmining:726
Rv1017c prsA ribose-phosphate pyrophosphokinase 563 75 textmining:548
Rv0308 integral membrane protein 674 53 textmining:670

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): decaprenylphosphoryl-D-2-keto erythropentose reductase
  • Pfam (hmmscan --cut_ga): adh_short PF00106.32 (E=8e-28), KR PF08659.17 (E=1e-05), adh_short_C2 PF13561.13 (E=4e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218308.1)
  • Domains: Pfam-A via hmmscan --cut_ga — adh_short (PF00106.32), KR (PF08659.17), adh_short_C2 (PF13561.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1028
  • Curated reference: UniProt P9WGS9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor dprE1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3791|dprE2
MVLDAVGNPQTVLLLGGTSEIGLAICERYLHNSAARIVLACLPDDPRREDAAAAMKQAGARSVELIDFDALDTDSHPKMIEAAFSGGDVDVAIVAFGLLGDAEELWQNQRKAVQIAEINYTAAVSVGVLLAEKMRAQGFGQIIAMSSAAGERVRRANFVYGSTKAGLDGFYLGLSEALREYGVRVLVIRPGQVRTRMSAHLKEAPLTVDKEYVANLAVTASAKGKELVWAPAAFRYVMMVLRHIPRSIFRKLPI