pncA Resolved · high auto-curated

H37Rv Rv2043c · MTBC0 mtbc0_002176 · 186 aa · 2317294–2317854 (-) · RefSeq NP_216559.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)pyrazinamidase/nicotinamidase PncA
MTBC0 PGAP re-annotationpyrazinamidase PncA
Revised (this work)Pyrazinamidase PncA. Pfam: Isochorismatase (PF00857.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XD65 SwissProt · reviewed · Evidence at protein level
UniProt nameNicotinamidase/pyrazinamidase
EC (curated) EC 3.5.1.-, EC 3.5.1.19
Curated functionCatalyzes the deamidation of nicotinamide (NAM) into nicotinate. Likely functions in the cyclical salvage pathway for production of NAD from nicotinamide (By similarity)..; FUNCTION: Is involved in the activation of the first-line antituberculous drug pyrazinamide (PZA) by converting it into the active form, pyrazinoic acid.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
Preferred namepncA
eggNOG descriptionIsochorismatase family
Orthologous groupCOG1335
EC number EC 3.5.1.19
KEGG orthology K08281
KEGG pathways map00760, map01100
Gene Ontology (39) GO:0003674, GO:0003824, GO:0005488, GO:0005506, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006766, GO:0006767, GO:0006769, GO:0006807 +27 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 5.304 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 31 missense, 1 nonsense, 2 frameshift
Disruption 3 distinct premature-stop/frameshift site(s); most common in 0.39% of strains (571) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
IsochorismatasePF00857.27 1.1e-293–182 Isochorismatase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pncB1 (nicotinic acid phosphoribosyltransferase PncB1), high confidence from genomic context alone (score 988 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1330c pncB1 nicotinic acid phosphoribosyltransferase PncB1 994 988 ctx fusion:567 cooccurence:654 database:900 textmining:585
Rv0573c pncB2 nicotinic acid phosphoribosyltransferase PncB2 987 977 ctx fusion:410 cooccurence:572 database:900 textmining:475
Rv1151c cobB NAD-dependent protein deacylase 927 917 database:900
Rv3393 iunH nucleoside hydrolase 928 913 database:900
Rv3307 deoD purine nucleoside phosphorylase 908 903 database:900
Rv2042c hyp hypothetical protein 943 888 ctx neighborhood:882 textmining:514
Rv2041c sugar ABC transporter substrate-binding lipoprotein 693 694 ctx neighborhood:684
Rv2044c hyp hypothetical protein 888 691 ctx neighborhood:690 textmining:652
Rv2037c transmembrane protein 674 675 ctx neighborhood:664
Rv2040c sugar ABC transporter permease 670 671 ctx neighborhood:666
Rv2039c sugar ABC transporter permease 669 670 ctx neighborhood:666
Rv2038c ugpC sugar ABC transporter ATP-binding protein 668 669 ctx neighborhood:666
Rv3433c nnr bifunctional ADP-dependent (S)-NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase 653 654 coexpression:644
Rv2045c lipT carboxylesterase LipT 576 575 ctx neighborhood:569
Rv2982c gpdA2 glycerol-3-phosphate dehydrogenase 522 505 coexpression:412

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: pyrazinamidase/nicotinamidase PncA
  • MTBC0 PGAP product: pyrazinamidase PncA
  • Pfam (hmmscan --cut_ga): Isochorismatase PF00857.27 (E=1e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216559.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Isochorismatase (PF00857.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1335
  • Curated reference: UniProt I6XD65 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 101 functional partner(s); context anchor pncB1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002176|Rv2043c|pncA
MRALIIVDVQNDFCEGGSLAVTGGAALARAISDYLAEAADYHHVVATKDFHIDPGDHFSGTPDYSSSWPPHCVSGTPGADFHPSLDTSAIEAVFYKGAYTGAYSGFEGVDENGTPLLNWLRQRGVDEVDVVGIATDHCVRQTAEDAVRNGLATRVLVDLTAGVSADTTVAALEEMRTASVELVCSS