pncA Resolved · high auto-curated
H37Rv Rv2043c · MTBC0 mtbc0_002176 ·
186 aa ·
2317294–2317854 MTBC0
(-) ·
RefSeq NP_216559.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | pyrazinamidase/nicotinamidase PncA |
|---|---|
| MTBC0 PGAP re-annotation | pyrazinamidase PncA |
| Revised (this work) | Pyrazinamidase PncA. Pfam: Isochorismatase (PF00857.27). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 433 publications
433 TB publications mention this gene. 433 publication(s) discuss this gene (431 in a M. tuberculosis context, 12 in other mycobacteria — M. smegmatis (9), M. marinum (2), M. abscessus (1), M. leprae (1)).
| Publication | Date |
|---|---|
| Toward precision detection of pyrazinamide resistance: critical concentration assessment and rapid molecular method validation. doi:10.3389/fmicb.2026.1828630 | 2026 |
| Pyrazinamide susceptibility testing in Mycobacterium tuberculosis: impact of false-positive BD MGIT 960 results and added value of sequencing for accurate diagnosis in a low-MDR-TB-incidence context. doi:10.3389/fcimb.2026.1777714 | 2026 |
| Genetic Characterization of First-Line Drug-Resistance Mutations in Multidrug-Resistant Mycobacterium tuberculosis. doi:10.3390/pathogens15050455 | 2026 |
| Effects of mutations conferring pyrazinamide resistance among multidrug-resistant tuberculosis isolates from China. doi:10.1128/spectrum.00641-26 | 2026 |
| Evaluation of DNA extraction methods from clinical Mycobacterium tuberculosis primary liquid culture for whole-genome sequencing. doi:10.1186/s12864-026-12812-w | 2026 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | Rv2042c (Rv2042c, - strand) |
|---|---|
| Overlap | 1 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 1.11 (95% CI -0.94 to 4.62). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Converts amides such as nicotinamide to corresponding acid. |
|---|---|
| Mycobrowser EC |
3.5.1.-
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2069c
· 99.5% identity |
|---|---|
| M. marinum |
MMAR_3016
· 69.2% identity |
| M. smegmatis |
MSMEG_6506
· 66.5% identity |
| M. orygis |
RJtmp_002115
· 100.0% identity |
| M. abscessus |
MAB_1472c
· 59.3% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
I6XD65
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Nicotinamidase/pyrazinamidase |
| EC (curated) |
EC 3.5.1.-, EC 3.5.1.19
|
| Curated function | Catalyzes the deamidation of nicotinamide (NAM) into nicotinate. Likely functions in the cyclical salvage pathway for production of NAD from nicotinamide (By similarity)..; FUNCTION: Is involved in the activation of the first-line antituberculous drug pyrazinamide (PZA) by converting it into the active form, pyrazinoic acid. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| Preferred name | pncA |
| eggNOG description | Isochorismatase family |
| Orthologous group | COG1335 |
| EC number |
EC 3.5.1.19
|
| KEGG orthology |
K08281
|
| KEGG pathways |
map00760, map01100
|
| Gene Ontology (39) |
GO:0003674, GO:0003824, GO:0005488, GO:0005506, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006766, GO:0006767, GO:0006769, GO:0006807 +27 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 5.304 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 31 missense, 1 nonsense, 2 frameshift |
| Disruption | 3 distinct premature-stop/frameshift site(s); most common in 0.39% of strains (571) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 71.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 54.4% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 12 in the ORF — 0 in the essential state, 0 growth-defect, 12 non-essential, 0 growth-advantage. Saturation 0.917, mean read count 83.6363636364. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Conditional fitness (RB-TnSeq, 95 conditions) stress
| Condition | Group | Direction | log2 fitness | t |
|---|---|---|---|---|
| Pyrazinamide | stress | mutant enriched (loss advantageous) | 2.446 | 7.862 |
Randomly-barcoded transposon screen across 95 carbon/nitrogen sources, pH, stressors and antibiotics (1 condition-specific phenotype(s) for this gene). A conditional fitness phenotype is a context lead, not a proven function, and never changes the verdict here. Note the blind spot: RB-TnSeq cannot measure essential genes. Source: RB-TnSeq 95-condition barcoded transposon screen, Mtb (PLoS Biol 2026, doi:10.1371/journal.pbio.3003529).
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | +2.60 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +2.55 | 0.0 | disruption advantageous |
| altered fitness under high iron concentrations (stress) | -2.55 | 0.05 | required |
| fitness in mouse infection (in vivo) | +2.49 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +2.44 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +2.42 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +2.22 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +2.02 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.44 | 0.025 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 9 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Drug resistance (WHO catalogue) pyrazinamide
| pyrazinamide | 1193 catalogued resistance-associated variant(s) |
|---|
This gene carries mutations classed Associated with resistance (WHO grade 1–2) in the consolidated catalogue (WHO 2nd ed. 2023 + tb-profiler). Only the R-associated tier is shown; "uncertain" and empirical-only signals are excluded. Test a specific strain or variant with the resistance tester. Research context, not a clinical diagnostic.
Proteomics (mass spectrometry) detected
| MS detection | detected in 12 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 96.4 ppm · rank 1317/3519 (62.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 186 aa |
|---|---|
| Molecular weight | 19.6 kDa |
| Theoretical pI | 4.43 |
| GRAVY | 0.002 (hydrophobic) |
| Aliphatic index | 83.9 |
| Aromaticity | 0.075 |
| Instability index | 10.4 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Isochorismatase | PF00857.27 | 1.1e-29 | 3–182 | Isochorismatase domain |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
3pl1 |
X-ray diffraction | 2.2 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3pl1-assembly1_A |
1.00 | 0.99 | 5.7e-36 sig | 3pl1-assembly1_A Determination of the crystal structure of the pyrazinamidase from M.tuberculosis : a structure-function analysis for prediction resistance to pyrazinamide. |
3r2j-assembly2_C |
1.00 | 0.87 | 5.3e-18 sig | 3r2j-assembly2_C Crystal Structure of PnC1 from L. infantum in complex with nicotinate |
1im5-assembly1_A |
1.00 | 0.85 | 1.7e-16 sig | 1im5-assembly1_A Crystal Structure of Pyrazinamidase of Pyrococcus horikoshii in Complex with Zinc |
2wt9-assembly1_A |
1.00 | 0.80 | 6.4e-17 sig | 2wt9-assembly1_A Acinetobacter baumanii nicotinamidase pyrazinamidease |
3hb7-assembly4_G |
1.00 | 0.78 | 3.4e-12 sig | 3hb7-assembly4_G The Crystal Structure of an Isochorismatase-like Hydrolase from Alkaliphilus metalliredigens to 2.3A |
Foldseek search of the AlphaFold DB model (mean pLDDT 97.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Catalytic-site verification (M-CSA on the structural model)
| M-CSA entry | 716 · EC 3.5.1.19 |
|---|---|
| Catalytic residues | 7/9 identical (9/9 aligned) |
| Verdict | PARTIAL (7/9 identical, 9/9 aligned) -> active site partly retained; verify (possible distant homolog / weak alignment) |
Catalytic residues of the matched M-CSA reference enzyme mapped onto the structural model by alignment. An active-site-conserved verdict upgrades a mere fold match to a likely active enzyme; fold-only flags a shared fold whose catalytic machinery is not retained (a guard against over-calling).
Genomic context (neighbours & predicted operon) operon of 8
| Upstream (5' on genome) | Rv2042c (- strand, -1 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2044c (- strand, 40 bp gap) |
| Predicted operon |
Rv2037c · Rv2038c · Rv2039c · Rv2040c · Rv2041c · Rv2042c · pncA · Rv2044c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: pncB1 (nicotinic acid phosphoribosyltransferase PncB1), high confidence from genomic context alone (score 988 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1330c pncB1 exp |
nicotinic acid phosphoribosyltransferase PncB1 | 994 | 988 ctx | fusion:567 cooccurence:654 database:900 textmining:585 |
Rv0573c pncB2 exp |
nicotinic acid phosphoribosyltransferase PncB2 | 987 | 977 ctx | fusion:410 cooccurence:572 database:900 textmining:475 |
Rv1151c cobB exp |
NAD-dependent protein deacylase | 927 | 917 | database:900 |
Rv3393 iunH exp |
nucleoside hydrolase | 928 | 913 | database:900 |
Rv3307 deoD exp |
purine nucleoside phosphorylase | 908 | 903 | database:900 |
Rv2042c hyp |
hypothetical protein | 943 | 888 ctx | neighborhood:882 textmining:514 |
Rv2041c |
sugar ABC transporter substrate-binding lipoprotein | 693 | 694 ctx | neighborhood:684 |
Rv2044c hyp |
hypothetical protein | 888 | 691 ctx | neighborhood:690 textmining:652 |
Rv2037c |
transmembrane protein | 674 | 675 ctx | neighborhood:664 |
Rv2040c |
sugar ABC transporter permease | 670 | 671 ctx | neighborhood:666 |
Rv2039c |
sugar ABC transporter permease | 669 | 670 ctx | neighborhood:666 |
Rv2038c ugpC |
sugar ABC transporter ATP-binding protein | 668 | 669 ctx | neighborhood:666 |
Rv3433c nnr |
bifunctional ADP-dependent (S)-NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase | 653 | 654 | coexpression:644 |
Rv2045c lipT |
carboxylesterase LipT | 576 | 575 ctx | neighborhood:569 |
Rv2982c gpdA2 |
glycerol-3-phosphate dehydrogenase | 522 | 505 | coexpression:412 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: pyrazinamidase/nicotinamidase PncA
- MTBC0 PGAP product: pyrazinamidase PncA
- Pfam (hmmscan --cut_ga): Isochorismatase PF00857.27 (E=1e-29)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216559.1)
- Domains: Pfam-A via hmmscan --cut_ga — Isochorismatase (PF00857.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1335 - Curated reference: UniProt I6XD65 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.3)
- Catalytic-site verification: M-CSA (Ribeiro et al. 2018, doi:10.1093/nar/gkx1012), entry 716; catalytic residues aligned onto the structural model
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
101 functional partner(s); context anchor
pncB1 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Drug resistance: consolidated catalogue, WHO 2nd ed. 2023 (9789240082410) + tb-profiler; only the resistance-associated tier (grade 1–2) is surfaced
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002176|Rv2043c|pncA MRALIIVDVQNDFCEGGSLAVTGGAALARAISDYLAEAADYHHVVATKDFHIDPGDHFSGTPDYSSSWPPHCVSGTPGADFHPSLDTSAIEAVFYKGAYTGAYSGFEGVDENGTPLLNWLRQRGVDEVDVVGIATDHCVRQTAEDAVRNGLATRVLVDLTAGVSADTTVAALEEMRTASVELVCSS
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for pncA? Email the maintainer — the message is pre-filled with this gene's details.