Rv1823 Family assigned · low

H37Rv Rv1823 · MTBC0 mtbc0_001937 · 307 aa · 2087790–2088713 (+) · RefSeq NP_216339.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF881 domain-containing protein
Revised (this work)Small coiled-coil membrane protein, candidate divisome / cell-division-associated component (FtsB/FtsL-like); paralog of the uncharacterized Rv1825; coiled-coil fold limits confidence RefSeq leaves this locus uncharacterised.

Curated reference (UniProt)

UniProt P9WFG1 SwissProt · reviewed · Evidence at protein level
UniProt nameUPF0749 protein Rv1823

UniProt still lists this protein as UPF0749 protein Rv1823; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionBacterial protein of unknown function (DUF881)
Orthologous groupCOG3879
Gene Ontology (12) GO:0005575, GO:0005623, GO:0005886, GO:0005887, GO:0016020, GO:0016021, GO:0031224, GO:0031226, GO:0044425, GO:0044459, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.495 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF881PF05949.18 1.3e-34150–303 Bacterial protein of unknown function (DUF881)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pgsA2 (CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase), high confidence from genomic context alone (score 883 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1824 hyp hypothetical protein 992 992 ctx neighborhood:839 cooccurence:774 coexpression:797
Rv1822 pgsA2 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 883 883 ctx neighborhood:882
Rv1825 hyp hypothetical protein 921 882 ctx neighborhood:822
Rv1826 gcvH glycine cleavage system protein H 781 781 ctx neighborhood:778
Rv1821 secA2 accessory Sec system translocase SecA2 738 738 ctx neighborhood:736
Rv3300c hyp hypothetical protein 738 738 coexpression:738
Rv1820 ilvG acetolactate synthase large subunit IlvG 728 729 ctx neighborhood:728
Rv1828 HTH-type transcriptional regulator 684 684 ctx neighborhood:676
Rv1827 garA glycogen accumulation regulator GarA 657 656 ctx neighborhood:653
Rv1819c bacA vitamin B12 transport ATP-binding protein BacA 651 652 ctx neighborhood:650
Rv1829 hyp hypothetical protein 904 537 ctx neighborhood:527 textmining:803
Rv1009 rpfB resuscitation-promoting factor RpfB 466 466 ctx cooccurence:457
Rv3301c phoY1 phosphate transport system transcriptional regulator PhoY 457 458 coexpression:458
Rv2375 hyp hypothetical protein 448 448 ctx cooccurence:447
Rv2612c pgsA1 CDP-diacylglycerol--inositol 3-phosphatidyltransferase 675 174 textmining:623

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • HHpred: top hit paralog Rv1825 (uncharacterized) 100% E1.2e-35; then divisome FtsB/FtsL 94-96% + M.tb cell-division/PG proteins (MctB, RipA, NlpC/P60) - above the coiled-coil de-novo-peptide noise floor (90-93%)
  • HHpred web (MPI Bioinformatics Toolkit, profile-profile remote homology), interpreted in project 'Still unknown gene function', 2026-06-10. A fold/family-level assignment, not a demonstrated function.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216339.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF881 (PF05949.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3879
  • Curated reference: UniProt P9WFG1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 88.0, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor pgsA2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001937|Rv1823|
MAESDRLLGGYDPNAGYSAHAGAQPQRIPVPSLLRALLSEHLDAGYAAVAAERERAAAPRCWQARAVSWMWQALAATLVAAVFAAAVAQARSVAPGVRAAQQLLVASVRSTQAAATTLAQRRSTLSAKVDDVRRIVLADDAEGQRLLARLDVLSLAAASAPVVGPGLTVTVTDPGASPNLSDVSKQRVSGSQQIILDRDLQLVVNSLWESGAEAISIDGVRIGPNVTIRQAGGAILVDNNPTSSPYTILAVGPPHAMQDVFDRSAGLYRLRLLETSYGVGVSVNVGDGLALPAGATRDVKFAKQIGP