fadE18 Family assigned · medium auto-curated

H37Rv Rv1933c · MTBC0 mtbc0_002047 · 363 aa · 2202982–2204073 (-) · RefSeq NP_216449.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)acyl-CoA dehydrogenase FadE18
MTBC0 PGAP re-annotationacyl-CoA dehydrogenase family protein
Revised (this work)Acyl-CoA dehydrogenase family protein. Pfam: Acyl-CoA_dh_N (PF02771.22), Acyl-CoA_dh_1 (PF00441.30), Acyl-CoA_dh_2 (PF08028.17).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P95281 TrEMBL · unreviewed · Inferred from homology
UniProt nameProbable acyl-CoA dehydrogenase FadE18

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namefadE18
eggNOG descriptionacyl-CoA dehydrogenase
Orthologous groupCOG1960

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.739 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 5.04% of strains (7314) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Acyl-CoA_dh_NPF02771.22 1.6e-167–113 Acyl-CoA dehydrogenase, N-terminal domain
Acyl-CoA_dh_1PF00441.30 1.9e-36214–358 Acyl-CoA dehydrogenase, C-terminal domain
Acyl-CoA_dh_2PF08028.17 6.7e-11226–341 Acyl-CoA dehydrogenase, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadE17 (acyl-CoA dehydrogenase FadE17), high confidence from genomic context alone (score 963 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1934c fadE17 acyl-CoA dehydrogenase FadE17 984 963 ctx neighborhood:782 cooccurence:773 textmining:586
Rv1935c echA13 enoyl-CoA hydratase EchA13 934 888 ctx neighborhood:747 textmining:439
Rv3028c fixB electron transfer flavoprotein subunit alpha 850 844 ctx cooccurence:567 coexpression:412 experimental:419
Rv3560c fadE30 acyl-CoA dehydrogenase FadE30 849 844 ctx fusion:420 cooccurence:740
Rv3029c fixA electron transfer flavoprotein subunit beta 846 840 ctx cooccurence:563 coexpression:406 experimental:418
Rv3562 fadE31 acyl-CoA dehydrogenase FadE31 859 816 ctx cooccurence:738
Rv0860 fadB fatty oxidation protein FadB 802 787 coexpression:646
Rv3543c fadE29 acyl-CoA dehydrogenase FadE29 769 770 ctx cooccurence:727
Rv1679 fadE16 acyl-CoA dehydrogenase FadE16 768 768 ctx cooccurence:766
Rv3504 fadE26 acyl-CoA dehydrogenase FadE26 797 745 ctx cooccurence:728
Rv0131c fadE1 acyl-CoA dehydrogenase FadE1 735 735 ctx cooccurence:735
Rv3797 fadE35 acyl-CoA dehydrogenase FadE35 721 721 ctx cooccurence:720
Rv2766c short-chain type dehydrogenase/reductase 707 697 ctx neighborhood:544
Rv1937 oxygenase 703 684 ctx neighborhood:479
Rv1346 mbtN acyl-[acyl-carrier-protein 661 661 ctx cooccurence:659

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: acyl-CoA dehydrogenase FadE18
  • MTBC0 PGAP product: acyl-CoA dehydrogenase family protein
  • Pfam (hmmscan --cut_ga): Acyl-CoA_dh_N PF02771.22 (E=2e-16), Acyl-CoA_dh_1 PF00441.30 (E=2e-36), Acyl-CoA_dh_2 PF08028.17 (E=7e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216449.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Acyl-CoA_dh_N (PF02771.22), Acyl-CoA_dh_1 (PF00441.30), Acyl-CoA_dh_2 (PF08028.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1960
  • Curated reference: UniProt P95281 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 124 functional partner(s); context anchor fadE17
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002047|Rv1933c|fadE18
MDFRYSTEQDDFRASLRGFLGRGAPVREMAAADGSDRRLWQRLCTELELPALHVPPEHGGLGATLVETAIAFAELGRALTPIPFAATVFAIEAILRMGDDEQRKRLLAGLLTGARIGTIAVSGHDVASATTVRAVRRDGRPALTGECTPVLHGHVADLFVVPAVADGSIVLHVVAADAPGVTVTPLPSFDITRPVATLRLAGSPAEPLTAGTPDDMERVLDVARVLLAAEMLGGAEACLDLAVQYAGRRTQFDRPIGSFQAVKHACADMMIEIDATRATVMFAAMSAANGDELQTVAPLAKAQTAETFVLCAGSALQIHGAIAFTWEHDLHLYYRRAKTTEALFGSSARNRALLAERAGLVKA