rpmF Resolved · high auto-curated

H37Rv Rv0979A · MTBC0 - · 57 aa · 1094886–1095059 (+) · RefSeq YP_177635.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L32
MTBC0 PGAP re-annotation
Revised (this work)50S ribosomal protein L32. Pfam: Ribosomal_L32p (PF01783.30).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WH99 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein bL32

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpmF
eggNOG descriptionBelongs to the bacterial ribosomal protein bL32 family
Orthologous group2DRA3
KEGG orthology K02911
KEGG pathways map03010
KEGG modules M00178

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.352 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L32pPF01783.30 6.8e-092–45 Ribosomal L32p protein family

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv3456c rplQ 50S ribosomal protein L17 999 1000 coexpression:851 experimental:999 textmining:570
Rv0706 rplV 50S ribosomal protein L22 999 1000 coexpression:821 experimental:999
Rv1643 rplT 50S ribosomal protein L20 999 1000 coexpression:859 experimental:999
Rv0685 tuf elongation factor Tu 993 993 coexpression:845 experimental:928 database:404
Rv0708 rplP 50S ribosomal protein L16 991 991 coexpression:822 experimental:928
Rv2412 rpsT 30S ribosomal protein S20 997 990 coexpression:865 experimental:928 textmining:731
Rv1642 rpmI 50S ribosomal protein L35 995 990 coexpression:859 experimental:928 textmining:549
Rv3461c rpmJ 50S ribosomal protein L36 995 990 coexpression:850 experimental:928 textmining:606
Rv2909c rpsP 30S ribosomal protein S16 993 990 coexpression:861 experimental:928
Rv2442c rplU 50S ribosomal protein L21 992 990 coexpression:859 experimental:928
Rv2785c rpsO 30S ribosomal protein S15 992 990 coexpression:859 experimental:928
Rv2904c rplS 50S ribosomal protein L19 992 990 coexpression:859 experimental:928
Rv0053 rpsF 30S ribosomal protein S6 992 990 coexpression:857 experimental:928
Rv0652 rplL 50S ribosomal protein L7/L12 992 990 coexpression:860 experimental:928
Rv2441c rpmA 50S ribosomal protein L27 991 990 coexpression:852 experimental:928

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 50S ribosomal protein L32
  • Pfam (hmmscan --cut_ga): Ribosomal_L32p PF01783.30 (E=7e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177635.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L32p (PF01783.30)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DRA3
  • Curated reference: UniProt P9WH99 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 240 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0979A|rpmF
MAVPKRRKSRSNTRSRRSQWKAAKTELVGVTVAGHAHKVPRRLLKAARLGLIDFDKR