rpmF Resolved · high auto-curated
H37Rv Rv0979A · MTBC0 - ·
57 aa ·
1094886–1095059 H37Rv
(+) ·
RefSeq YP_177635.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 50S ribosomal protein L32 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | 50S ribosomal protein L32. Pfam: Ribosomal_L32p (PF01783.30). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) never studied
No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 32% of residues (metapredict) · mean AlphaFold pLDDT 93.4 |
|---|---|
| Disordered regions | 1 IDR(s), longest 18 aa [0-18] |
carries a substantial disordered region (18/57 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
CRISPRi vulnerability
Vulnerability index -6.58 (95% CI -7.90 to -5.29). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in translation mechanism. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1005
· 100.0% identity |
|---|---|
| M. leprae |
ML0173
· 84.2% identity |
| M. marinum |
MMAR_4530
· 84.2% identity |
| M. smegmatis |
MSMEG_5489
· 75.4% identity |
| M. orygis |
RJtmp_001034
· 100.0% identity |
| M. abscessus |
MAB_1075
· 84.2% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WH99
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Large ribosomal subunit protein bL32 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | rpmF |
| eggNOG description | Belongs to the bacterial ribosomal protein bL32 family |
| Orthologous group | 2DRA3 |
| KEGG orthology |
K02911
|
| KEGG pathways |
map03010
|
| KEGG modules |
M00178
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.352 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 85.2%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 9/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 66.1% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | Uncertain · uncertain |
|---|---|
| What the call means | uncertain (short or TA-poor ORF): no call possible |
| TA sites (Himar1) | 2 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 2 growth-advantage. Saturation 0.500, mean read count 1. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Statistically thin call: only 2 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 1277.0 ppm · rank 171/3519 (95.2th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 57 aa |
|---|---|
| Molecular weight | 6.5 kDa |
| Theoretical pI | 12.0 |
| GRAVY | -0.789 (hydrophilic) |
| Aliphatic index | 78.8 |
| Aromaticity | 0.035 |
| Instability index | 90.2 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Ribosomal_L32p | PF01783.30 | 6.8e-09 | 2–45 | Ribosomal L32p protein family |
Experimental structures (Protein Data Bank) 11 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
7sfr |
Electron Microscopy | 2.6 Å | 100% |
7kgb |
Electron Microscopy | 2.7 Å | 100% |
7mt7 |
Electron Microscopy | 2.71 Å | 100% |
7mt2 |
Electron Microscopy | 2.76 Å | 100% |
7msm |
Electron Microscopy | 2.79 Å | 100% |
7mt3 |
Electron Microscopy | 2.8 Å | 100% |
7msc |
Electron Microscopy | 2.97 Å | 100% |
7msz |
Electron Microscopy | 3.1 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (11 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.4
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
7kgb-assembly1_0 |
1.00 | 0.95 | 6.5e-08 sig | 7kgb-assembly1_0 CryoEM structure of A2296-methylated Mycobacterium tuberculosis ribosome bound with SEQ-9 |
7mt7-assembly1_0 |
1.00 | 0.95 | 6.5e-08 sig | 7mt7-assembly1_0 Mtb 70S with P and E site tRNAs |
8fr8-assembly1_8 |
1.00 | 0.95 | 4.3e-06 sig | 8fr8-assembly1_8 Structure of Mycobacterium smegmatis Rsh bound to a 70S translation initiation complex |
5o61-assembly1_b |
1.00 | 0.95 | 4.9e-06 sig | 5o61-assembly1_b The complete structure of the Mycobacterium smegmatis 70S ribosome |
5xym-assembly1_0 |
1.00 | 0.93 | 7.0e-06 sig | 5xym-assembly1_0 Large subunit of Mycobacterium smegmatis |
Foldseek search of the AlphaFold DB model (mean pLDDT 93.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv0979c (- strand, 21 bp gap) |
|---|---|
| Downstream (3' on genome) | PE_PGRS18 (- strand, 18 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3456c rplQ exp |
50S ribosomal protein L17 | 999 | 1000 | coexpression:851 experimental:999 textmining:570 |
Rv0706 rplV exp |
50S ribosomal protein L22 | 999 | 1000 | coexpression:821 experimental:999 |
Rv1643 rplT exp |
50S ribosomal protein L20 | 999 | 1000 | coexpression:859 experimental:999 |
Rv0685 tuf exp |
elongation factor Tu | 993 | 993 | coexpression:845 experimental:928 database:404 |
Rv0708 rplP exp |
50S ribosomal protein L16 | 991 | 991 | coexpression:822 experimental:928 |
Rv2412 rpsT exp |
30S ribosomal protein S20 | 997 | 990 | coexpression:865 experimental:928 textmining:731 |
Rv1642 rpmI exp |
50S ribosomal protein L35 | 995 | 990 | coexpression:859 experimental:928 textmining:549 |
Rv3461c rpmJ exp |
50S ribosomal protein L36 | 995 | 990 | coexpression:850 experimental:928 textmining:606 |
Rv2909c rpsP exp |
30S ribosomal protein S16 | 993 | 990 | coexpression:861 experimental:928 |
Rv2442c rplU exp |
50S ribosomal protein L21 | 992 | 990 | coexpression:859 experimental:928 |
Rv2785c rpsO exp |
30S ribosomal protein S15 | 992 | 990 | coexpression:859 experimental:928 |
Rv2904c rplS exp |
50S ribosomal protein L19 | 992 | 990 | coexpression:859 experimental:928 |
Rv0053 rpsF exp |
30S ribosomal protein S6 | 992 | 990 | coexpression:857 experimental:928 |
Rv0652 rplL exp |
50S ribosomal protein L7/L12 | 992 | 990 | coexpression:860 experimental:928 |
Rv2441c rpmA exp |
50S ribosomal protein L27 | 991 | 990 | coexpression:852 experimental:928 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 50S ribosomal protein L32
- Pfam (hmmscan --cut_ga): Ribosomal_L32p PF01783.30 (E=7e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177635.1)
- Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L32p (PF01783.30)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2DRA3 - Curated reference: UniProt P9WH99 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.4)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 240 functional partner(s)
- Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0979A|rpmF MAVPKRRKSRSNTRSRRSQWKAAKTELVGVTVAGHAHKVPRRLLKAARLGLIDFDKR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for rpmF? Email the maintainer — the message is pre-filled with this gene's details.