Rv0038 Family assigned · low

H37Rv Rv0038 · MTBC0 mtbc0_000043 · 202 aa · 41403–42011 (+) · RefSeq NP_214552.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationYqgE/AlgH family protein
Revised (this work)UPF0301 / YqgE/AlgH family protein (Pfam DUF179, PF02622). A widely conserved bacterial family of unknown precise molecular function; the AlgH homolog has been linked to alginate regulation in Pseudomonas, but the activity is uncharacterised. Role in M. tuberculosis unknown.

Curated reference (UniProt)

UniProt P9WFK5 SwissProt · reviewed · Evidence at protein level
UniProt nameUPF0301 protein Rv0038

UniProt still lists this protein as UPF0301 protein Rv0038; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionBelongs to the UPF0301 (AlgH) family
Orthologous groupCOG1678
KEGG orthology K07735
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF179PF02622.22 1.1e-3331–184 AlgH-like

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0037c (MFS-type transporter), high confidence from genomic context alone (score 765 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3051c nrdE ribonucleoside-diphosphate reductase subunit alpha 969 966 coexpression:560 experimental:789 database:662
Rv0570 nrdZ vitamin B12-dependent ribonucleoside-diphosphate reductase 969 965 coexpression:548 experimental:789 database:662
Rv1019 transcriptional regulator 841 841 coexpression:841
Rv1359 transcriptional regulator 823 823 coexpression:802
Rv1488 hyp hypothetical protein 805 806 coexpression:804
Rv0691c mftR mycofactocin biosynthesis transcriptional regulator MftR 798 798 coexpression:798
Rv3263 DNA methylase 797 797 coexpression:797
Rv1776c transcriptional regulator 797 797 coexpression:797
Rv0212c nadR transcriptional regulator NadR 794 795 coexpression:767
Rv2788 sirR transcriptional repressor SirR 793 793 coexpression:793
Rv1152 transcriptional regulator 781 781 coexpression:780
Rv0894 transcriptional regulator 772 772 coexpression:772
Rv1674c transcriptional regulator 765 766 coexpression:758
Rv0037c MFS-type transporter 765 765 ctx neighborhood:762
Rv1100 hyp hypothetical protein 763 764 coexpression:730

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: 'YqgE/AlgH family protein'
  • Pfam: DUF179 PF02622 (E=1.1e-33) -- UPF0301 / YqgE/AlgH family, conserved but functionally uncharacterised
  • No Mtb-specific functional study found in tbmonitor (2021-2026)

ESM Atlas signal (exploratory)

Ancestral protein hash 0cce37a4c66121ebb2d0e82af00406ec · 10 ESM-space neighbours (max similarity 0.944). SAE features are orienting indices, not validated domains.

#IndexActivationInterpretation
116204 0.95 Aromatic-anchored disulfide loop motif
23864 0.77 NTase ligase/GTase catalytic cores
313483 0.76 Phosphoryl group binding pocket
4198 0.65 N-terminal gating loops
57714 0.54 C-terminal cofactor-binding tails
65122 0.53 Basic histidine polyanion binding loops
78075 0.53 Amphipathic C-terminal helix-loop linker
83114 0.51 Active-site rim β-loop elements

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214552.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF179 (PF02622.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1678
  • Curated reference: UniProt P9WFK5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 70 functional partner(s); context anchor Rv0037c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000043|Rv0038|
MVAPHEDPEDHVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNDGGTLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRVGADPEGVPGLRHVAGRLVMVDLDADPEVLAAAVEGVRIYAGYSGWTIGQLEGEIERDDWIVLSALPSDVLVGPRADLWGQVLRRQPLPLSLLATHPIDLSRN