lpdA Resolved · high auto-curated

H37Rv Rv3303c · MTBC0 mtbc0_003511 · 471 aa · 3711537–3713018 (-) · RefSeq NP_217820.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)NAD(P)H quinone reductase LpdA
MTBC0 PGAP re-annotationNAD(P)H-quinone dehydrogenase
Revised (this work)NAD(P)H-quinone dehydrogenase. Pfam: Pyr_redox_2 (PF07992.21), Pyr_redox (PF00070.34), Pyr_redox_dim (PF02852.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHH7 SwissProt · reviewed · Evidence at protein level
UniProt nameNAD(P)H dehydrogenase
EC (curated) EC 1.6.5.2
Curated functionMay contribute to virulence by increasing resistance to reactive oxygen intermediates. It can reduce 2,6-dimethyl-1,4-benzoquinone (DMBQ), 5-hydroxy-1,4-naphthaquinone (5-HNQ) and menadione. NADPH is the physiological reductant rather than NADH.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namelpdA
eggNOG descriptionPyruvate 2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase
Orthologous groupCOG1249
EC number EC 1.8.1.4
KEGG orthology K00382
KEGG pathways map00010, map00020, map00260, map00280, map00620, map00630, map00640, map01100, map01110, map01120, map01130, map01200
KEGG modules M00009, M00011, M00036, M00307, M00532
Gene Ontology (25) GO:0000166, GO:0003674, GO:0003824, GO:0003955, GO:0005488, GO:0008150, GO:0008152, GO:0009405, GO:0016491, GO:0016651, GO:0016655, GO:0036094 +13 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.657 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 6 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 98.67% of strains (143282) · reference-fixed

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Pyr_redox_2PF07992.21 1.4e-504–332 Pyridine nucleotide-disulphide oxidoreductase
Pyr_redoxPF00070.34 1.2e-16184–262 Pyridine nucleotide-disulphide oxidoreductase
Pyr_redox_dimPF02852.29 3.0e-25352–461 Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: glpD2 (glycerol-3-phosphate dehydrogenase), high confidence from genomic context alone (score 971 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1248c kgd multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase 999 999 coexpression:755 experimental:970 database:844 textmining:553
Rv3302c glpD2 glycerol-3-phosphate dehydrogenase 983 971 ctx neighborhood:869 coexpression:791 textmining:447
Rv2496c bkdB 3-methyl-2-oxobutanoate dehydrogenase subunit beta 968 958 ctx cooccurence:472 coexpression:645 experimental:465 database:617
Rv2495c bkdC branched-chain keto acid dehydrogenase E2 component 953 951 ctx cooccurence:663 coexpression:453 experimental:443 database:565
Rv2215 dlaT pyruvate dehydrogenase E2 component dihydrolipoamide acyltransferase 965 924 ctx cooccurence:468 coexpression:464 experimental:443 database:565 textmining:570
Rv2497c bkdA 3-methyl-2-oxobutanoate dehydrogenase subunit alpha 899 880 ctx cooccurence:462 coexpression:497 database:580
Rv0843 dehydrogenase 877 870 ctx cooccurence:414 coexpression:497 database:580
Rv1734c hyp hypothetical protein 866 860 coexpression:451 experimental:443 database:565
Rv1826 gcvH glycine cleavage system protein H 857 805 ctx cooccurence:485 database:622
Rv0526 thioredoxin 809 801 experimental:410 database:550
Rv3300c hyp hypothetical protein 870 779 ctx neighborhood:759 textmining:437
Rv1017c prsA ribose-phosphate pyrophosphokinase 793 777 database:615
Rv3304 hyp hypothetical protein 951 762 ctx neighborhood:757 textmining:805
Rv2211c gcvT aminomethyltransferase 778 760 database:569
Rv2874 dipZ integral membrane C-type cytochrome biogenesis protein DipZ 765 753 experimental:410 database:550

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: NAD(P)H quinone reductase LpdA
  • MTBC0 PGAP product: NAD(P)H-quinone dehydrogenase
  • Pfam (hmmscan --cut_ga): Pyr_redox_2 PF07992.21 (E=1e-50), Pyr_redox PF00070.34 (E=1e-16), Pyr_redox_dim PF02852.29 (E=3e-25)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217820.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pyr_redox_2 (PF07992.21), Pyr_redox (PF00070.34), Pyr_redox_dim (PF02852.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1249
  • Curated reference: UniProt P9WHH7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 109 functional partner(s); context anchor glpD2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003511|Rv3303c|lpdA
MVTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGFHIDFDDAKISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTSATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMAHDDLD