lpdA Resolved · high auto-curated
H37Rv Rv3303c · MTBC0 mtbc0_003511 ·
471 aa ·
3711537–3713018 MTBC0
(-) ·
RefSeq NP_217820.1
⚠ The ancestral MTBC0 ORF appears truncated by an internal (premature) stop codon: the translated ancestral protein (471 aa) is shorter than its annotated CDS span (≈493 aa / 1482 bp). This is expected for degraded mobile elements (phage, IS, transposase); for a conserved gene it more likely reflects a reconstruction artefact in MTBC0 v1.1. Note: the structural and functional layers below were computed on the translated (truncated) sequence.
Non-canonical microproteins (overlapping smORFs)
1 MS-proven microprotein from the separate microproteome track overlap this locus (existence proven, function unknown; not counted among the canonical genes).
| Microprotein | Relationship | Length | Essentiality |
|---|---|---|---|
| tORF_89298 | same-strand overlap (alternative frame) | 66 aa | — |
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | NAD(P)H quinone reductase LpdA |
|---|---|
| MTBC0 PGAP re-annotation | NAD(P)H-quinone dehydrogenase |
| Revised (this work) | NAD(P)H-quinone dehydrogenase. Pfam: Pyr_redox_2 (PF07992.21), Pyr_redox (PF00070.34), Pyr_redox_dim (PF02852.29). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 8 publications
8 TB publications mention this gene. 8 publication(s) discuss this gene (8 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Updated Erdman reveals tandem repeat copy number is phase-variable and impacts M. tuberculosis adaptation across evolutionary timescales. doi:10.1128/msystems.01026-25 | 2026 |
| Comparative Genomic Analysis of Two Clonally Related Multidrug Resistant Mycobacterium tuberculosis by Single Molecule Real Time Sequencing. doi:10.3389/fcimb.2017.00478 | 2017 |
| [Comparison of the promoter activity of metabolism-related pabB and lpdA genes between Mycobacterium tuberculosis strains H37Rv and H37Ra]. | 2010 |
| Variable-number tandem repeat 3690 polymorphism in Indian clinical isolates of Mycobacterium tuberculosis and its influence on transcription. doi:10.1099/jmm.0.002550-0 | 2009 |
| Rv3303c of Mycobacterium tuberculosis protects tubercle bacilli against oxidative stress in vivo and contributes to virulence in mice. doi:10.1016/j.micinf.2006.09.004 | 2006 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -12.30 (95% CI -17.00 to -7.01). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in energy metabolism. Can catalyze the reduction of electron acceptors such as 2,6-dimethyl-1,4-benzoquinone (DMBQ) and 5-hydroxy-1,4-napthaquinone (5-HNQ) [catalytic activity: NAD(P)H + a quinone + H+ -> a quinol + NAD(P)+]. |
|---|---|
| Mycobrowser EC |
1.6.5.2
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3331c
· 99.6% identity |
|---|---|
| M. marinum |
MMAR_1224
· 92.1% identity |
| M. smegmatis |
MSMEG_1735
· 78.7% identity |
| M. orygis |
RJtmp_003403
· 99.8% identity |
| M. abscessus |
MAB_3656c
· 76.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHH7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | NAD(P)H dehydrogenase |
| EC (curated) |
EC 1.6.5.2
|
| Curated function | May contribute to virulence by increasing resistance to reactive oxygen intermediates. It can reduce 2,6-dimethyl-1,4-benzoquinone (DMBQ), 5-hydroxy-1,4-naphthaquinone (5-HNQ) and menadione. NADPH is the physiological reductant rather than NADH. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | lpdA |
| eggNOG description | Pyruvate 2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase |
| Orthologous group | COG1249 |
| EC number |
EC 1.8.1.4
|
| KEGG orthology |
K00382
|
| KEGG pathways |
map00010, map00020, map00260, map00280, map00620, map00630, map00640, map01100, map01110, map01120, map01130, map01200
|
| KEGG modules |
M00009, M00011, M00036, M00307, M00532
|
| Gene Ontology (25) |
GO:0000166, GO:0003674, GO:0003824, GO:0003955, GO:0005488, GO:0008150, GO:0008152, GO:0009405, GO:0016491, GO:0016651, GO:0016655, GO:0036094 +13 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.657 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 6 missense, 1 nonsense, 0 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 98.67% of strains (143282) · reference-fixed |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 3 consensus substitution(s) · 1 canettii-fixed disruption low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable; carries 1 M. canettii-clade-fixed disruptive substitution(s) (candidate lineage-specific pseudogenisation — cross-check the intra-MTBC pseudogene layer) |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 87.6%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 10/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 64.2% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 22 in the ORF — 0 in the essential state, 0 growth-defect, 22 non-essential, 0 growth-advantage. Saturation 0.955, mean read count 45.380952381. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB)
| Condition | log2FC | q | Effect |
|---|---|---|---|
| Differential genetic requirements of clinical Mtb strain (ID=632) from East Asian lineage (compared to H37Rv control) (strain background) | +2.72 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=621) from East Asian lineage (compared to H37Rv control) (strain background) | +2.34 | 0.0082 | required |
| Differential genetic requirements of clinical Mtb strain (ID=662) from East Asian lineage (compared to H37Rv control) (strain background) | +2.13 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=667) from Indo-Oceanic lineage (compared to H37Rv control) (strain background) | +2.13 | 0.014 | required |
| Differential genetic requirements of clinical Mtb strain (ID=641) from Indo-Oceanic lineage (compared to H37Rv control) (strain background) | +1.67 | 0.031 | required |
Conditional fitness of transposon-disruption mutants across 5 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 13 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 116.0 ppm · rank 1192/3519 (66.2th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 471 aa |
|---|---|
| Molecular weight | 49.2 kDa |
| Theoretical pI | 5.96 |
| GRAVY | 0.262 (hydrophobic) |
| Aliphatic index | 105.6 |
| Aromaticity | 0.038 |
| Instability index | 34.1 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Pyr_redox_2 | PF07992.21 | 1.4e-50 | 4–332 | Pyridine nucleotide-disulphide oxidoreductase |
Pyr_redox | PF00070.34 | 1.2e-16 | 184–262 | Pyridine nucleotide-disulphide oxidoreductase |
Pyr_redox_dim | PF02852.29 | 3.0e-25 | 352–461 | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
1xdi |
X-ray diffraction | 2.81 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.7
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
1xdi-assembly1_A |
1.00 | 0.98 | 4.5e-85 sig | 1xdi-assembly1_A Crystal structure of LpdA (Rv3303c) from Mycobacterium tuberculosis |
1ebd-assembly1_B |
1.00 | 0.95 | 1.5e-45 sig | 1ebd-assembly1_B DIHYDROLIPOAMIDE DEHYDROGENASE COMPLEXED WITH THE BINDING DOMAIN OF THE DIHYDROLIPOAMIDE ACETYLASE |
6uzi-assembly2_D |
1.00 | 0.92 | 1.8e-45 sig | 6uzi-assembly2_D Crystal structure of Dihydrolipoyl dehydrogenase from Elizabethkingia anophelis NUHP1 |
3urh-assembly1_A |
1.00 | 0.93 | 3.5e-44 sig | 3urh-assembly1_A Crystal structure of a dihydrolipoamide dehydrogenase from Sinorhizobium meliloti 1021 |
5tr3-assembly1_A |
1.00 | 0.91 | 1.8e-44 sig | 5tr3-assembly1_A 2.5 Angstrom Resolution Crystal Structure of Dihydrolipoyl Dehydrogenase from Pseudomonas putida in Complex with FAD. |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | glpD2 (- strand, 14 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv3304 (+ strand, 202 bp gap) |
| Predicted operon |
glpD2 · lpdA
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
Rv1719 (represses) · Rv2989 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: glpD2 (glycerol-3-phosphate dehydrogenase), high confidence from genomic context alone (score 971 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1248c kgd exp |
multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase | 999 | 999 | coexpression:755 experimental:970 database:844 textmining:553 |
Rv3302c glpD2 |
glycerol-3-phosphate dehydrogenase | 983 | 971 ctx | neighborhood:869 coexpression:791 textmining:447 |
Rv2496c bkdB exp |
3-methyl-2-oxobutanoate dehydrogenase subunit beta | 968 | 958 ctx | cooccurence:472 coexpression:645 experimental:465 database:617 |
Rv2495c bkdC exp |
branched-chain keto acid dehydrogenase E2 component | 953 | 951 ctx | cooccurence:663 coexpression:453 experimental:443 database:565 |
Rv2215 dlaT exp |
pyruvate dehydrogenase E2 component dihydrolipoamide acyltransferase | 965 | 924 ctx | cooccurence:468 coexpression:464 experimental:443 database:565 textmining:570 |
Rv2497c bkdA exp |
3-methyl-2-oxobutanoate dehydrogenase subunit alpha | 899 | 880 ctx | cooccurence:462 coexpression:497 database:580 |
Rv0843 exp |
dehydrogenase | 877 | 870 ctx | cooccurence:414 coexpression:497 database:580 |
Rv1734c hyp exp |
hypothetical protein | 866 | 860 | coexpression:451 experimental:443 database:565 |
Rv1826 gcvH exp |
glycine cleavage system protein H | 857 | 805 ctx | cooccurence:485 database:622 |
Rv0526 exp |
thioredoxin | 809 | 801 | experimental:410 database:550 |
Rv3300c hyp |
hypothetical protein | 870 | 779 ctx | neighborhood:759 textmining:437 |
Rv1017c prsA exp |
ribose-phosphate pyrophosphokinase | 793 | 777 | database:615 |
Rv3304 hyp |
hypothetical protein | 951 | 762 ctx | neighborhood:757 textmining:805 |
Rv2211c gcvT exp |
aminomethyltransferase | 778 | 760 | database:569 |
Rv2874 dipZ exp |
integral membrane C-type cytochrome biogenesis protein DipZ | 765 | 753 | experimental:410 database:550 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: NAD(P)H quinone reductase LpdA
- MTBC0 PGAP product: NAD(P)H-quinone dehydrogenase
- Pfam (hmmscan --cut_ga): Pyr_redox_2 PF07992.21 (E=1e-50), Pyr_redox PF00070.34 (E=1e-16), Pyr_redox_dim PF02852.29 (E=3e-25)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217820.1)
- Domains: Pfam-A via hmmscan --cut_ga — Pyr_redox_2 (PF07992.21), Pyr_redox (PF00070.34), Pyr_redox_dim (PF02852.29)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1249 - Curated reference: UniProt P9WHH7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.7)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
109 functional partner(s); context anchor
glpD2 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003511|Rv3303c|lpdA MVTRIVILGGGPAGYEAALVAATSHPETTQVTVIDCDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGFHIDFDDAKISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDSTPGLARHRIKATAADGSTSEHEADVVLVATGASPRILPSAQPDGERILTWRQLYDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPYEDADAALVLEESFAERGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVGIQLGRGNYLTVDRVSRTSATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMAHDDLD
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for lpdA? Email the maintainer — the message is pre-filled with this gene's details.