ugpC Family assigned · medium auto-curated

H37Rv Rv2832c · MTBC0 mtbc0_003011 · 360 aa · 3158765–3159847 (-) · RefSeq NP_217348.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
MTBC0 PGAP re-annotationABC transporter ATP-binding protein
Revised (this work)ABC transporter ATP-binding protein. Pfam: ABC_tran (PF00005.34), OB_MalK (PF17912.8).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6X5H3 TrEMBL · unreviewed · Evidence at protein level
UniProt nameTrehalose import ATP-binding protein SugC
Curated functionPart of the ABC transporter complex LpqY-SugA-SugB-SugC, which is highly specific for uptake of trehalose. Involved in the recycling of extracellular trehalose released from trehalose-containing molecules synthesized by M.tuberculosis. Trehalose uptake is essential for virulence. Responsible for energy coupling to the transport system.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred nameugpC
eggNOG descriptionABC transporter
Orthologous groupCOG3842
EC number EC 3.6.3.20
KEGG orthology K05816, K10112
KEGG pathways map02010
KEGG modules M00194, M00196, M00197, M00198, M00200, M00201, M00206, M00207, M00491, M00602, M00605, M00606

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.606 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 8 missense, 2 nonsense, 0 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 2.85% of strains (4139) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ABC_tranPF00005.34 1.2e-3122–163 ABC transporter
OB_MalKPF17912.8 4.2e-06237–277 MalK OB fold domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ugpA (sn-glycerol-3-phosphate ABC transporter permease UgpA), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2835c ugpA sn-glycerol-3-phosphate ABC transporter permease UgpA 999 999 ctx neighborhood:882 cooccurence:761 coexpression:476 experimental:458 database:900 textmining:860
Rv2834c ugpE sn-glycerol-3-phosphate ABC transporter permease UgpE 999 999 ctx neighborhood:882 cooccurence:767 coexpression:628 experimental:441 database:900 textmining:574
Rv2833c ugpB sn-glycerol-3-phosphate ABC transporter substrate-binding lipoprotein UgpB 999 996 ctx neighborhood:882 coexpression:580 experimental:469 database:800 textmining:825
Rv1237 sugB sugar ABC transporter permease SugB 982 979 ctx cooccurence:741 coexpression:440 experimental:858
Rv1236 sugA sugar ABC transporter permease SugA 985 968 ctx cooccurence:719 coexpression:466 experimental:788 textmining:557
Rv2316 uspA sugar ABC transporter permease UspA 969 932 ctx cooccurence:767 coexpression:468 experimental:458 textmining:573
Rv2040c sugar ABC transporter permease 953 932 ctx cooccurence:771 coexpression:470 experimental:458
Rv2039c sugar ABC transporter permease 978 931 ctx cooccurence:769 coexpression:443 experimental:441 textmining:702
Rv2317 uspB sugar ABC transporter permease UspB 978 925 ctx cooccurence:763 coexpression:440 experimental:441 textmining:721
Rv2041c sugar ABC transporter substrate-binding lipoprotein 955 860 ctx cooccurence:505 coexpression:468 experimental:444 textmining:695
Rv1235 lpqY trehalose ABC transporter substrate-binding lipoprotein LpqY 857 720 coexpression:465 experimental:469 textmining:513
Rv2318 uspC sugar ABC transporter substrate-binding lipoprotein UspC 936 673 coexpression:476 textmining:814
Rv2838c rbfA ribosome-binding factor RbfA 579 579 ctx neighborhood:578
Rv3041c ABC transporter ATP-binding protein 577 577 database:540
Rv2837c nrnA bifunctional oligoribonuclease/PAP phosphatase NrnA 572 573 ctx neighborhood:572

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
  • MTBC0 PGAP product: ABC transporter ATP-binding protein
  • Pfam (hmmscan --cut_ga): ABC_tran PF00005.34 (E=1e-31), OB_MalK PF17912.8 (E=4e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217348.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ABC_tran (PF00005.34), OB_MalK (PF17912.8)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3842
  • Curated reference: UniProt I6X5H3 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 30 functional partner(s); context anchor ugpA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003011|Rv2832c|ugpC
MANVQYSAVTQRYPGADAPTVDNLDLDIADGEFLVLVGPSGCGKSTTLRVLAGLEPIESGRISIGDVDVTHLPPRARDVAMVFQNYALYPNMTVAANMGFALRNAGMSRADTRRRVLEVADMLELTDLLDRKPAKLSGGQRQRVAMGRAIVRRPRVFCMDEPLSNLDAKLRVSTRSQISGLQRRLGTTTVYVTHDQVEAMTMGDRVAVLKDGVLQQVDTPRALYDDPVNTFVATFIGAPAMNLIDAAVAHGVVRAPDLAIPVPDPAAERVLVGVRPESWDVASIGTPGSLTVHVELVEELGFESFVYATPVDQRGWSSRAPRIVFRTDRRTAVRVGESLAIVPHSQEVRLFNSRTETRLR