vapC33 Family assigned · medium auto-curated

H37Rv Rv1242 · MTBC0 mtbc0_001331 · 143 aa · 1392979–1393410 (+) · RefSeq NP_215758.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ribonuclease VapC33
MTBC0 PGAP re-annotationtype II toxin-antitoxin system VapC family toxin
Revised (this work)Type II toxin-antitoxin system VapC family toxin. Pfam: PIN (PF01850.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WF69 SwissProt · reviewed · Evidence at protein level
UniProt nameRibonuclease VapC33
EC (curated) EC 3.1.-.-
Curated functionToxic component of a type II toxin-antitoxin (TA) system. An RNase (By similarity). Upon expression in M.smegmatis inhibits colony formation. Its toxic effect is neutralized by coexpression with cognate antitoxin VapB33.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionToxic component of a toxin-antitoxin (TA) module. An RNase
Orthologous groupCOG1848
KEGG orthology K07064
Gene Ontology (12) GO:0005575, GO:0005623, GO:0005886, GO:0008150, GO:0016020, GO:0040008, GO:0044464, GO:0045926, GO:0048519, GO:0050789, GO:0065007, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PINPF01850.28 2.4e-062–134 PIN domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapB33 (antitoxin VapB33), high confidence from genomic context alone (score 896 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1241 vapB33 antitoxin VapB33 896 896 ctx neighborhood:882
Rv1240 mdh malate dehydrogenase 630 630 ctx neighborhood:611
Rv0748 vapB31 antitoxin VapB31 526 527 experimental:508
Rv2871 vapB43 antitoxin VapB43 525 526 experimental:508
Rv0595c vapC4 ribonuclease VapC4 815 493 ctx cooccurence:488 textmining:651
Rv0626 vapB5 antitoxin VapB5 488 489 ctx cooccurence:478
Rv1720c vapC12 ribonuclease VapC12 438 439 ctx cooccurence:438
Rv1239c corA magnesium and cobalt transport transmembrane protein CorA 424 425 ctx neighborhood:421
Rv0960 vapC9 ribonuclease VapC9 414 414 ctx cooccurence:411
Rv2548 vapC19 ribonuclease VapC19 595 409 ctx cooccurence:407
Rv1114 vapC32 ribonuclease VapC32 861 326 textmining:803
Rv1838c vapC13 ribonuclease VapC13 406 316
Rv0065 vapC1 ribonuclease VapC1 545 308
Rv2549c vapC20 ribonuclease VapC20 653 295 textmining:529
Rv2010 vapC15 ribonuclease VapC15 725 242 textmining:653

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ribonuclease VapC33
  • MTBC0 PGAP product: type II toxin-antitoxin system VapC family toxin
  • Pfam (hmmscan --cut_ga): PIN PF01850.28 (E=2e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215758.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PIN (PF01850.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1848
  • Curated reference: UniProt P9WF69 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 30 functional partner(s); context anchor vapB33
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001331|Rv1242|vapC33
MIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVDLLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE