uspB Family assigned · medium auto-curated
H37Rv Rv2317 · MTBC0 - ·
274 aa · 2589697–2590521 (+) ·
RefSeq YP_177866.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | sugar ABC transporter permease UspB |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Sugar ABC transporter permease UspB. Pfam: BPD_transp_1 (PF00528.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
L7N652
TrEMBL · unreviewed
· Inferred from homology
|
|---|---|
| UniProt name | Probable sugar-transport integral membrane protein ABC transporter UspB |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | uspB |
| eggNOG description | ABC transporter |
| Orthologous group | COG0395 |
| KEGG orthology |
K02026
|
| KEGG modules |
M00207
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.143 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
BPD_transp_1 | PF00528.28 | 8.6e-20 | 86–267 | Binding-protein-dependent transport system inner membrane component |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: uspA (sugar ABC transporter permease UspA), high confidence from genomic context alone (score 999 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2316 uspA |
sugar ABC transporter permease UspA | 999 | 999 ctx | neighborhood:882 cooccurence:774 coexpression:530 experimental:412 database:900 textmining:461 |
Rv2318 uspC |
sugar ABC transporter substrate-binding lipoprotein UspC | 997 | 987 ctx | neighborhood:882 cooccurence:615 coexpression:559 experimental:412 textmining:806 |
Rv2835c ugpA |
sn-glycerol-3-phosphate ABC transporter permease UgpA | 980 | 931 ctx | cooccurence:774 coexpression:481 experimental:412 textmining:733 |
Rv2040c |
sugar ABC transporter permease | 972 | 929 ctx | cooccurence:774 coexpression:480 experimental:412 textmining:627 |
Rv2832c ugpC |
sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | 978 | 925 ctx | cooccurence:763 coexpression:440 experimental:441 textmining:721 |
Rv2038c ugpC |
sugar ABC transporter ATP-binding protein | 967 | 925 ctx | cooccurence:764 coexpression:438 experimental:441 textmining:580 |
Rv1236 sugA |
sugar ABC transporter permease SugA | 957 | 925 ctx | cooccurence:760 coexpression:484 experimental:412 textmining:453 |
Rv1238 sugC |
sugar ABC transporter ATP-binding protein SugC | 947 | 922 ctx | cooccurence:762 coexpression:439 experimental:441 |
Rv2041c |
sugar ABC transporter substrate-binding lipoprotein | 956 | 919 ctx | cooccurence:741 coexpression:444 experimental:412 textmining:490 |
Rv2833c ugpB |
sn-glycerol-3-phosphate ABC transporter substrate-binding lipoprotein UgpB | 937 | 862 ctx | cooccurence:586 coexpression:448 experimental:412 textmining:565 |
Rv2315c hyp |
hypothetical protein | 789 | 790 ctx | neighborhood:790 |
Rv2314c hyp |
hypothetical protein | 789 | 790 ctx | neighborhood:790 |
Rv2313c hyp |
hypothetical protein | 787 | 788 ctx | neighborhood:788 |
Rv1235 lpqY |
trehalose ABC transporter substrate-binding lipoprotein LpqY | 831 | 759 | coexpression:445 experimental:412 |
Rv3604c |
transmembrane protein | 444 | 424 | coexpression:404 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): sugar ABC transporter permease UspB
- Pfam (hmmscan --cut_ga): BPD_transp_1 PF00528.28 (E=9e-20)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177866.1)
- Domains: Pfam-A via hmmscan --cut_ga — BPD_transp_1 (PF00528.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0395 - Curated reference: UniProt L7N652 (TrEMBL, unreviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
26 functional partner(s); context anchor
uspA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2317|uspB MSSPSRVSNTAVYAVLTIGAVITLSPFLLGLLTSFTSAHQFATGTPLQLPRPPTLANYADIADAGFRRAAVVTALMTAVILLGQLTFSVLAAYAFARLQFRGRDALFWVYVATLMVPGTVTVVPLYLMMAQLGLRNTFWALVLPFMFGSPYAIFLLREHFRLIPDDLINAARLDGANTLDVIVHVVIPSSRPVLAALAMITVVSQWNNFMWPLVITSGHKWRVLTVATADLQSRFNDQWTLVMAATTVAIVPLIALFVTFQRHIVASIVVSGLK