uspB Family assigned · medium auto-curated
H37Rv Rv2317 · MTBC0 - ·
274 aa ·
2589697–2590521 H37Rv
(+) ·
RefSeq YP_177866.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | sugar ABC transporter permease UspB |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Sugar ABC transporter permease UspB. Pfam: BPD_transp_1 (PF00528.28). |
| Functional category (TubercuList) | cell wall and cell processes |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 1 publication
1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Comparative diagnostic efficacy of ultrasound-guided, medical thoracoscopic, and blind pleural biopsy in tuberculous pleurisy. doi:10.21037/jtd-2025-1033 | 2025 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 2 % of gene
| Neighbour | uspA (Rv2316, + strand) |
|---|---|
| Overlap | 14 bp, 2 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 1.29 (95% CI -0.44 to 4.54). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Thought to be involved in active transport of sugar across the membrane (import). Responsible for the translocation of the substrate across the membrane. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2344
· 100.0% identity |
|---|---|
| M. leprae |
ML1769
· 85.0% identity |
| M. marinum |
MMAR_3618
· 86.6% identity |
| M. smegmatis |
MSMEG_4467
· 79.5% identity |
| M. orygis |
RJtmp_002398
· 100.0% identity |
| M. abscessus |
MAB_1716c
· 74.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
L7N652
TrEMBL · unreviewed
· Inferred from homology
|
|---|---|
| UniProt name | Probable sugar-transport integral membrane protein ABC transporter UspB |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | uspB |
| eggNOG description | ABC transporter |
| Orthologous group | COG0395 |
| KEGG orthology |
K02026
|
| KEGG modules |
M00207
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.143 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.09 (low power)
· 5 consensus substitution(s) low power (5 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 85.6%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 9/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 37.0% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 14 in the ORF — 0 in the essential state, 0 growth-defect, 14 non-essential, 0 growth-advantage. Saturation 0.786, mean read count 29.8181818182. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) not detected
Not detected in the mass-spectrometry datasets integrated by PaxDb. This is not evidence of absence: low-abundance, condition-specific, or MS-refractory proteins (e.g. small, highly hydrophobic, or repetitive PE/PPE families with few tryptic peptides) are systematically under-sampled.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (6 TM helixes) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 6 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 274 aa |
|---|---|
| Molecular weight | 29.9 kDa |
| Theoretical pI | 10.38 |
| GRAVY | 0.791 (hydrophobic) |
| Aliphatic index | 122.1 |
| Aromaticity | 0.106 |
| Instability index | 37.7 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
BPD_transp_1 | PF00528.28 | 8.6e-20 | 86–267 | Binding-protein-dependent transport system inner membrane component |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 89.4
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8ja7-assembly1_B |
1.00 | 0.79 | 1.1e-10 sig | 8ja7-assembly1_B Cryo-EM structure of Mycobacterium tuberculosis LpqY-SugABC in complex with trehalose |
8hpn-assembly1_B |
1.00 | 0.79 | 3.4e-10 sig | 8hpn-assembly1_B LpqY-SugABC in state 3 |
3puv-assembly1_G |
1.00 | 0.79 | 1.1e-09 sig | 3puv-assembly1_G Crystal Structure of an outward-facing MBP-Maltose transporter complex bound to ADP-VO4 |
4tqv-assembly2_F |
1.00 | 0.83 | 2.3e-09 sig | 4tqv-assembly2_F Crystal structure of a bacterial ABC transporter involved in the import of the acidic polysaccharide alginate |
4jbw-assembly2_I |
1.00 | 0.83 | 4.0e-09 sig | 4jbw-assembly2_I Crystal structure of E. coli maltose transporter MalFGK2 in complex with its regulatory protein EIIAglc |
Foldseek search of the AlphaFold DB model (mean pLDDT 89.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | uspA (+ strand, -14 bp gap) |
|---|---|
| Downstream (3' on genome) | uspC (+ strand, -4 bp gap) |
| Predicted operon |
uspA · uspB · uspC
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: uspA (sugar ABC transporter permease UspA), high confidence from genomic context alone (score 999 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2316 uspA exp |
sugar ABC transporter permease UspA | 999 | 999 ctx | neighborhood:882 cooccurence:774 coexpression:530 experimental:412 database:900 textmining:461 |
Rv2318 uspC exp |
sugar ABC transporter substrate-binding lipoprotein UspC | 997 | 987 ctx | neighborhood:882 cooccurence:615 coexpression:559 experimental:412 textmining:806 |
Rv2835c ugpA exp |
sn-glycerol-3-phosphate ABC transporter permease UgpA | 980 | 931 ctx | cooccurence:774 coexpression:481 experimental:412 textmining:733 |
Rv2040c exp |
sugar ABC transporter permease | 972 | 929 ctx | cooccurence:774 coexpression:480 experimental:412 textmining:627 |
Rv2832c ugpC exp |
sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | 978 | 925 ctx | cooccurence:763 coexpression:440 experimental:441 textmining:721 |
Rv2038c ugpC exp |
sugar ABC transporter ATP-binding protein | 967 | 925 ctx | cooccurence:764 coexpression:438 experimental:441 textmining:580 |
Rv1236 sugA exp |
sugar ABC transporter permease SugA | 957 | 925 ctx | cooccurence:760 coexpression:484 experimental:412 textmining:453 |
Rv1238 sugC exp |
sugar ABC transporter ATP-binding protein SugC | 947 | 922 ctx | cooccurence:762 coexpression:439 experimental:441 |
Rv2041c exp |
sugar ABC transporter substrate-binding lipoprotein | 956 | 919 ctx | cooccurence:741 coexpression:444 experimental:412 textmining:490 |
Rv2833c ugpB exp |
sn-glycerol-3-phosphate ABC transporter substrate-binding lipoprotein UgpB | 937 | 862 ctx | cooccurence:586 coexpression:448 experimental:412 textmining:565 |
Rv2315c hyp |
hypothetical protein | 789 | 790 ctx | neighborhood:790 |
Rv2314c hyp |
hypothetical protein | 789 | 790 ctx | neighborhood:790 |
Rv2313c hyp |
hypothetical protein | 787 | 788 ctx | neighborhood:788 |
Rv1235 lpqY exp |
trehalose ABC transporter substrate-binding lipoprotein LpqY | 831 | 759 | coexpression:445 experimental:412 |
Rv3604c |
transmembrane protein | 444 | 424 | coexpression:404 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): sugar ABC transporter permease UspB
- Pfam (hmmscan --cut_ga): BPD_transp_1 PF00528.28 (E=9e-20)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177866.1)
- Domains: Pfam-A via hmmscan --cut_ga — BPD_transp_1 (PF00528.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0395 - Curated reference: UniProt L7N652 (TrEMBL, unreviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 89.4)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
26 functional partner(s); context anchor
uspA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2317|uspB MSSPSRVSNTAVYAVLTIGAVITLSPFLLGLLTSFTSAHQFATGTPLQLPRPPTLANYADIADAGFRRAAVVTALMTAVILLGQLTFSVLAAYAFARLQFRGRDALFWVYVATLMVPGTVTVVPLYLMMAQLGLRNTFWALVLPFMFGSPYAIFLLREHFRLIPDDLINAARLDGANTLDVIVHVVIPSSRPVLAALAMITVVSQWNNFMWPLVITSGHKWRVLTVATADLQSRFNDQWTLVMAATTVAIVPLIALFVTFQRHIVASIVVSGLK
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for uspB? Email the maintainer — the message is pre-filled with this gene's details.