ugpE Family assigned · medium auto-curated

H37Rv Rv2834c · MTBC0 mtbc0_003013 · 275 aa · 3161153–3161980 (-) · RefSeq NP_217350.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)sn-glycerol-3-phosphate ABC transporter permease UgpE
MTBC0 PGAP re-annotationcarbohydrate ABC transporter permease
Revised (this work)Carbohydrate ABC transporter permease. Pfam: BPD_transp_1 (PF00528.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6Y1U3 TrEMBL · unreviewed · Inferred from homology
UniProt nameProbable Sn-glycerol-3-phosphate transport integral membrane protein ABC transporter UgpE

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred nameugpE
eggNOG descriptionBinding-protein-dependent transport system inner membrane component
Orthologous groupCOG0395
KEGG orthology K05815
KEGG pathways map02010
KEGG modules M00198

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
BPD_transp_1PF00528.28 7.6e-1586–264 Binding-protein-dependent transport system inner membrane component

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ugpC (sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2832c ugpC sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC 999 999 ctx neighborhood:882 cooccurence:767 coexpression:628 experimental:441 database:900 textmining:574
Rv2835c ugpA sn-glycerol-3-phosphate ABC transporter permease UgpA 999 999 ctx neighborhood:882 cooccurence:774 coexpression:602 experimental:412 database:900 textmining:930
Rv2833c ugpB sn-glycerol-3-phosphate ABC transporter substrate-binding lipoprotein UgpB 999 999 ctx neighborhood:882 cooccurence:763 coexpression:729 experimental:412 database:800
Rv2040c sugar ABC transporter permease 987 930 ctx cooccurence:774 coexpression:486 experimental:412 textmining:830
Rv2316 uspA sugar ABC transporter permease UspA 976 930 ctx cooccurence:774 coexpression:482 experimental:412 textmining:673
Rv2038c ugpC sugar ABC transporter ATP-binding protein 954 929 ctx cooccurence:762 coexpression:443 experimental:441
Rv1236 sugA sugar ABC transporter permease SugA 971 922 ctx cooccurence:751 coexpression:481 experimental:412 textmining:651
Rv1238 sugC sugar ABC transporter ATP-binding protein SugC 937 920 ctx cooccurence:759 coexpression:436 experimental:441
Rv2041c sugar ABC transporter substrate-binding lipoprotein 929 900 ctx cooccurence:693 coexpression:449 experimental:412
Rv2838c rbfA ribosome-binding factor RbfA 782 783 ctx neighborhood:782
Rv2839c infB translation initiation factor IF-2 773 773 ctx neighborhood:773
Rv2837c nrnA bifunctional oligoribonuclease/PAP phosphatase NrnA 744 744 ctx neighborhood:743
Rv2318 uspC sugar ABC transporter substrate-binding lipoprotein UspC 844 738 coexpression:449 experimental:412 textmining:430
Rv1235 lpqY trehalose ABC transporter substrate-binding lipoprotein LpqY 774 721 coexpression:444 experimental:412
Rv2836c dinF DNA-damage-inducible protein DinF 673 674 ctx neighborhood:668

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: sn-glycerol-3-phosphate ABC transporter permease UgpE
  • MTBC0 PGAP product: carbohydrate ABC transporter permease
  • Pfam (hmmscan --cut_ga): BPD_transp_1 PF00528.28 (E=8e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217350.1)
  • Domains: Pfam-A via hmmscan --cut_ga — BPD_transp_1 (PF00528.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0395
  • Curated reference: UniProt I6Y1U3 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor ugpC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003013|Rv2834c|ugpE
MTPDRLRSSVGYAAMLLVVTLIAGPLLFVFFTSFKDQPDIYAQPTSWWPLRWYPQNYRTATEQIPFWTFLRNSLIITSVLAVVKFTLGVLSAFGLVFVRFPGRTAVFLVIIAALMVPNQITVISNYALISHLGLRNTFAGIILPLAGVAFGTFLMRNHFLSLPAEIIEAARMDGARWWQLLLRVVLPMSRPTMVAVGVITVVNEWNEYLWPFLMSDDESVAPLPIGLTFLQQAEGVTNWGPVMAVTLLAMLPILLVFIALQRQMIKGLTSGAVKG