kstR Family assigned · medium auto-curated

H37Rv Rv3574 · MTBC0 mtbc0_003793 · 199 aa · 4040161–4040760 (+) · RefSeq NP_218091.3

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)HTH-type transcriptional regulator KstR
MTBC0 PGAP re-annotationcholesterol catabolism transcriptional regulator KstR
Revised (this work)Cholesterol catabolism transcriptional regulator KstR. Pfam: TetR_N (PF00440.30), TetR_C_20 (PF17925.7).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96856 SwissProt · reviewed · Evidence at protein level
UniProt nameHTH-type transcriptional repressor KstR
Curated functionControls the expression of genes used for utilizing diverse lipids as energy sources.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namekstR
eggNOG descriptionTranscriptional regulator
Orthologous groupCOG1309
KEGG orthology K22107
Gene Ontology (45) GO:0000976, GO:0001067, GO:0003674, GO:0003676, GO:0003677, GO:0003690, GO:0003700, GO:0005488, GO:0005515, GO:0005575, GO:0005622, GO:0005623 +33 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.171 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TetR_NPF00440.30 8.8e-1621–65 Bacterial regulatory proteins, tetR family
TetR_C_20PF17925.7 2.5e-3886–192 Tetracyclin repressor-like, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadE34 (acyl-CoA dehydrogenase FadE34), high confidence from genomic context alone (score 862 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3573c fadE34 acyl-CoA dehydrogenase FadE34 901 862 ctx neighborhood:730 cooccurence:503
Rv3541c chsH1 hyp hypothetical protein 819 790 ctx cooccurence:760
Rv3542c chsH2 hyp hypothetical protein 785 785 ctx cooccurence:754
Rv3521 hyp hypothetical protein 771 765 ctx cooccurence:765
Rv3522 ltp4 lipid transfer protein 800 717 ctx cooccurence:712
Rv3552 CoA-transferase subunit beta 716 716 ctx cooccurence:715
Rv3551 CoA-transferase subunit alpha 746 694 ctx cooccurence:692
Rv3527 hyp hypothetical protein 689 690 ctx cooccurence:688
Rv3526 kshA 3-ketosteroid-9-alpha-monooxygenase oxygenase subunit 924 659 ctx cooccurence:651 textmining:787
Rv3515c fadD19 acyl-CoA synthetase 796 655 ctx cooccurence:632 textmining:434
Rv3570c hsaA flavin-dependent monooxygenase oxygenase subunit HsaA 827 637 ctx cooccurence:634 textmining:544
Rv3531c hyp hypothetical protein 654 632 ctx cooccurence:628
Rv3568c hsaC extradiol dioxygenase 847 606 ctx cooccurence:605 textmining:629
Rv3529c hyp hypothetical protein 592 584 ctx cooccurence:568
Rv3550 echA20 enoyl-CoA hydratase EchA20 700 571 ctx cooccurence:565

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: HTH-type transcriptional regulator KstR
  • MTBC0 PGAP product: cholesterol catabolism transcriptional regulator KstR
  • Pfam (hmmscan --cut_ga): TetR_N PF00440.30 (E=9e-16), TetR_C_20 PF17925.7 (E=3e-38)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218091.3)
  • Domains: Pfam-A via hmmscan --cut_ga — TetR_N (PF00440.30), TetR_C_20 (PF17925.7)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1309
  • Curated reference: UniProt P96856 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 45 functional partner(s); context anchor fadE34
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003793|Rv3574|kstR
MAVLAESELGSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRSAVAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMANGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGDQDSA