ugpA Family assigned · medium auto-curated

H37Rv Rv2835c · MTBC0 mtbc0_003014 · 303 aa · 3161977–3162888 (-) · RefSeq NP_217351.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)sn-glycerol-3-phosphate ABC transporter permease UgpA
MTBC0 PGAP re-annotationsugar ABC transporter permease
Revised (this work)Sugar ABC transporter permease. Pfam: BPD_transp_1 (PF00528.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XFF3 TrEMBL · unreviewed · Inferred from homology
UniProt nameProbable Sn-glycerol-3-phosphate transport integral membrane protein ABC transporter UgpA

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred nameugpA
eggNOG descriptiontransport integral membrane protein ABC transporter
Orthologous groupCOG1175
KEGG orthology K05814
KEGG pathways map02010
KEGG modules M00198

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.48 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 7.32% of strains (10623) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
BPD_transp_1PF00528.28 7.2e-2195–302 Binding-protein-dependent transport system inner membrane component

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ugpC (sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2832c ugpC sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC 999 999 ctx neighborhood:882 cooccurence:761 coexpression:476 experimental:458 database:900 textmining:860
Rv2834c ugpE sn-glycerol-3-phosphate ABC transporter permease UgpE 999 999 ctx neighborhood:882 cooccurence:774 coexpression:602 experimental:412 database:900 textmining:930
Rv2833c ugpB sn-glycerol-3-phosphate ABC transporter substrate-binding lipoprotein UgpB 999 998 ctx neighborhood:882 cooccurence:769 coexpression:498 experimental:412 database:800 textmining:817
Rv2038c ugpC sugar ABC transporter ATP-binding protein 977 933 ctx cooccurence:753 coexpression:479 experimental:458 textmining:679
Rv2039c sugar ABC transporter permease 979 932 ctx cooccurence:774 coexpression:493 experimental:412 textmining:713
Rv2317 uspB sugar ABC transporter permease UspB 980 931 ctx cooccurence:774 coexpression:481 experimental:412 textmining:733
Rv1238 sugC sugar ABC transporter ATP-binding protein SugC 934 925 ctx cooccurence:743 coexpression:463 experimental:458
Rv1237 sugB sugar ABC transporter permease SugB 953 909 ctx cooccurence:716 coexpression:480 experimental:412 textmining:517
Rv2041c sugar ABC transporter substrate-binding lipoprotein 917 900 ctx cooccurence:708 coexpression:432 experimental:412
Rv2837c nrnA bifunctional oligoribonuclease/PAP phosphatase NrnA 784 785 ctx neighborhood:782
Rv2838c rbfA ribosome-binding factor RbfA 783 784 ctx neighborhood:782
Rv2839c infB translation initiation factor IF-2 783 783 ctx neighborhood:782
Rv2836c dinF DNA-damage-inducible protein DinF 781 782 ctx neighborhood:782
Rv2318 uspC sugar ABC transporter substrate-binding lipoprotein UspC 914 752 coexpression:430 experimental:412 textmining:670
Rv1235 lpqY trehalose ABC transporter substrate-binding lipoprotein LpqY 749 729 coexpression:426 experimental:412

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: sn-glycerol-3-phosphate ABC transporter permease UgpA
  • MTBC0 PGAP product: sugar ABC transporter permease
  • Pfam (hmmscan --cut_ga): BPD_transp_1 PF00528.28 (E=7e-21)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217351.1)
  • Domains: Pfam-A via hmmscan --cut_ga — BPD_transp_1 (PF00528.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1175
  • Curated reference: UniProt I6XFF3 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor ugpC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003014|Rv2835c|ugpA
MAAPQRARLRSSKERVRDYALFVVLVGPNVALLLLFVYRPLADNIRLSFFDWNVSDPSARFVGLSNYTEWFTRSDTRQIVFNTAVFTGAAVVGSMVLGLALAMLLDRPLRGRNLVRSTVFAPFVISGAAVGLAAQFVFDPHFGLIQDLLRRIGVGVPDFYQDARWALFMVTITYVWKNLGYTFVIYLAALQGVRRDLLEAAEIDGASRWAVFRRVLLPQLRPTTFFLSITVLINSLQVFDVINVMTRGGPEGTGTTTMVYQVYVETFRNFRAGYGATVATIMFLVLLAVTYYQVRVMDRGQRQ