lppT Still unknown · low auto-curated
H37Rv Rv1799 · MTBC0 mtbc0_001912 ·
63 aa · 2057170–2057361 (+) ·
RefSeq NP_216315.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | lipoprotein LppT |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53948
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Probable lipoprotein LppT |
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: PPE28 (PPE family protein PPE28), medium confidence from genomic context alone (score 623 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1800 PPE28 |
PPE family protein PPE28 | 623 | 623 ctx | neighborhood:529 |
Rv1337 |
integral membrane protein | 518 | 55 | textmining:511 |
Rv3821 sap |
integral membrane protein | 440 | 50 | textmining:435 |
Rv3064c |
integral membrane protein | 549 | 47 | textmining:547 |
Rv2390c hyp |
hypothetical protein | 533 | 46 | textmining:531 |
Rv2169c |
transmembrane protein | 521 | 46 | textmining:519 |
Rv1275 lprC |
lipoprotein LprC | 443 | 46 | textmining:441 |
Rv0619 galTb |
Rv0619, (MTCY19H5.02c), len: 181 aa (probable partial CDS). Probable galTb, second part of galactose-1-phosphate uridylyltransferase, highly | 438 | 46 | textmining:436 |
Rv3483c hyp |
hypothetical protein | 512 | 44 | textmining:511 |
Rv0227c |
membrane protein | 436 | 44 | textmining:435 |
Rv0625c |
transmembrane protein | 549 | 41 | textmining:549 |
Rv3271c |
integral membrane protein | 549 | 41 | textmining:549 |
Rv2525c hyp |
hypothetical protein | 440 | 41 | textmining:440 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: lipoprotein LppT
- MTBC0 PGAP product: hypothetical protein
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216315.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Curated reference: UniProt O53948 (TrEMBL, unreviewed; Predicted)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
13 functional partner(s); context anchor
PPE28 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001912|Rv1799|lppT MSVKSKNGRLAARVLVALAALFAMIALTGSACLAEGPPLGRNPQGAPAPVGGTVIVAPMHSGV