lppT Still unknown · low auto-curated

H37Rv Rv1799 · MTBC0 mtbc0_001912 · 63 aa · 2057170–2057361 (+) · RefSeq NP_216315.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LppT
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53948 TrEMBL · unreviewed · Predicted
UniProt nameProbable lipoprotein LppT

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PPE28 (PPE family protein PPE28), medium confidence from genomic context alone (score 623 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1800 PPE28 PPE family protein PPE28 623 623 ctx neighborhood:529
Rv1337 integral membrane protein 518 55 textmining:511
Rv3821 sap integral membrane protein 440 50 textmining:435
Rv3064c integral membrane protein 549 47 textmining:547
Rv2390c hyp hypothetical protein 533 46 textmining:531
Rv2169c transmembrane protein 521 46 textmining:519
Rv1275 lprC lipoprotein LprC 443 46 textmining:441
Rv0619 galTb Rv0619, (MTCY19H5.02c), len: 181 aa (probable partial CDS). Probable galTb, second part of galactose-1-phosphate uridylyltransferase, highly 438 46 textmining:436
Rv3483c hyp hypothetical protein 512 44 textmining:511
Rv0227c membrane protein 436 44 textmining:435
Rv0625c transmembrane protein 549 41 textmining:549
Rv3271c integral membrane protein 549 41 textmining:549
Rv2525c hyp hypothetical protein 440 41 textmining:440

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LppT
  • MTBC0 PGAP product: hypothetical protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216315.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt O53948 (TrEMBL, unreviewed; Predicted)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor PPE28
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001912|Rv1799|lppT
MSVKSKNGRLAARVLVALAALFAMIALTGSACLAEGPPLGRNPQGAPAPVGGTVIVAPMHSGV