esxH Resolved · high auto-curated

H37Rv Rv0288 · MTBC0 mtbc0_000307 · 96 aa · 355142–355432 (+) · RefSeq NP_214802.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ESAT-6-like protein EsxH
MTBC0 PGAP re-annotationtype VII secretion system effector EsxH
Revised (this work)Type VII secretion system effector EsxH. Pfam: WXG100 (PF06013.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WNK3 SwissProt · reviewed · Evidence at protein level
UniProt nameESAT-6-like protein EsxH
Curated functionEsxH, in complex with EsxG, disrupts ESCRT function and impairs host phagosome maturation, thereby promoting intracellular bacterial growth. The complex acts by interacting, via EsxH, with the host hepatocyte growth factor-regulated tyrosine kinase substrate (HGS/HRS), a component of the ESCRT machinery.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameesxH
eggNOG descriptionBelongs to the WXG100 family
Orthologous groupCOG4842

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
WXG100PF06013.19 3.2e-183–87 Proteins of 100 residues with WXG

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: esxG (ESAT-6 like protein EsxG), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0287 esxG ESAT-6 like protein EsxG 999 1000 ctx neighborhood:727 coexpression:860 experimental:993 textmining:993
Rv0289 espG3 ESX-3 secretion-associated protein EspG3 980 963 ctx neighborhood:859 coexpression:751 textmining:484
Rv3020c esxS ESAT-6 like protein EsxS 939 834 experimental:822 textmining:650
Rv0290 eccD3 ESX-3 secretion system protein EccD 874 789 ctx neighborhood:658 coexpression:409 textmining:429
Rv3874 esxB ESAT-6-like protein EsxB 976 734 coexpression:734 textmining:915
Rv0284 eccC3 ESX-3 secretion system protein EccC3 803 729 ctx neighborhood:588
Rv0291 mycP3 membrane-anchored mycosin MycP 737 721 ctx neighborhood:658
Rv0292 eccE3 ESX-3 secretion system protein EccE 835 711 ctx neighborhood:658 textmining:451
Rv1038c esxJ ESAT-6 like protein EsxJ 836 703 coexpression:703 textmining:473
Rv0286 PPE4 PPE family protein PPE4 940 620 ctx neighborhood:561 textmining:850
Rv0283 eccB3 ESX-3 secretion system protein EccB3 700 614 ctx neighborhood:588
Rv0282 eccA3 ESX-3 secretion system protein EccA 723 605 ctx neighborhood:588
Rv0285 PE5 PE family protein PE5 854 578 ctx neighborhood:578 textmining:669
Rv3875 esxA ESAT-6 protein EsxA 944 392 textmining:912
Rv0281 S-adenosylmethionine-dependent methyltransferase 587 372

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ESAT-6-like protein EsxH
  • MTBC0 PGAP product: type VII secretion system effector EsxH
  • Pfam (hmmscan --cut_ga): WXG100 PF06013.19 (E=3e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214802.1)
  • Domains: Pfam-A via hmmscan --cut_ga — WXG100 (PF06013.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4842
  • Curated reference: UniProt P9WNK3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 50 functional partner(s); context anchor esxG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000307|Rv0288|esxH
MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG