Rv1786 Resolved · high auto-curated

H37Rv Rv1786 · MTBC0 mtbc0_001899 · 67 aa · 2042839–2043042 (+) · RefSeq NP_216302.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ferredoxin
MTBC0 PGAP re-annotationferredoxin
Revised (this work)Ferredoxin. Pfam: Fer4_15 (PF13459.12), Fer4_13 (PF13370.12).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53937 SwissProt · reviewed · Evidence at protein level
UniProt nameFerredoxin FdxE
Curated functionFerredoxin that is the redox partner of cytochrome CYP143, a cytochrome P450 encoded by an adjacent gene.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
eggNOG description4Fe-4S single cluster domain of Ferredoxin I
Orthologous groupCOG1141

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.299 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Fer4_15PF13459.12 1.4e-143–60 4Fe-4S single cluster domain
Fer4_13PF13370.12 6.8e-086–58 4Fe-4S single cluster domain of Ferredoxin I

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cyp143 (cytochrome P450 Cyp143), high confidence from genomic context alone (score 743 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1785c cyp143 cytochrome P450 Cyp143 884 743 ctx neighborhood:707 textmining:569
Rv3060c GntR family transcriptional regulator 623 623 ctx cooccurence:622
Rv0138 hyp hypothetical protein 583 584 ctx cooccurence:580
Rv1795 eccD5 ESX-5 type VII secretion system protein EccD 599 539 ctx cooccurence:539
Rv3887c eccD2 ESX-2 secretion system protein EccD 580 518 ctx cooccurence:518
Rv3519 hyp hypothetical protein 495 495 ctx cooccurence:479
Rv3061c fadE22 acyl-CoA dehydrogenase FadE22 483 483 ctx cooccurence:480
Rv0771 4-carboxymuconolactone decarboxylase 479 479 ctx cooccurence:476
Rv1874 hyp hypothetical protein 462 462 ctx cooccurence:462
Rv1787 PPE25 PPE family protein PPE25 453 453 ctx neighborhood:452
Rv1006 hyp hypothetical protein 450 450 ctx cooccurence:447
Rv1868 hyp hypothetical protein 448 449 ctx cooccurence:443
Rv1782 eccB5 ESX-5 type VII secretion system protein EccB5 651 411 ctx cooccurence:411 textmining:433
Rv3503c fdxD ferredoxin FdxD 543 300
Rv1783 eccC5 ESX-5 type VII secretion system protein EccC5 577 277 textmining:439

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ferredoxin
  • MTBC0 PGAP product: ferredoxin
  • Pfam (hmmscan --cut_ga): Fer4_15 PF13459.12 (E=1e-14), Fer4_13 PF13370.12 (E=7e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216302.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Fer4_15 (PF13459.12), Fer4_13 (PF13370.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1141
  • Curated reference: UniProt O53937 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor cyp143
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001899|Rv1786|
MKVRLDPSRCVGHAQCYAVDPDLFPIDDSGNSILAEHEVRPEDMQLTRDGVAACPEMALILEEDDAD