cyp143 Resolved · high auto-curated
H37Rv Rv1785c · MTBC0 mtbc0_001898 ·
393 aa ·
2041458–2042639 MTBC0
(-) ·
RefSeq NP_216301.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | cytochrome P450 Cyp143 |
|---|---|
| MTBC0 PGAP re-annotation | cytochrome P450 |
| Revised (this work) | Cytochrome P450. Pfam: p450 (PF00067.28). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 1 publication
1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Structural insights into 3Fe-4S ferredoxins diversity in M. tuberculosis highlighted by a first redox complex with P450. doi:10.3389/fmolb.2022.1100032 | 2022 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Post-translational modifications
1 reported modified residue(s):
N-acetylthreonine @2.
Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).
CRISPRi vulnerability
Vulnerability index 0.71 (95% CI -3.11 to 5.96). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, supplementary Table S2 'mmc3.xlsx', bulk import via Europe PMC -- supersedes the per-gene pebble.rockefeller.edu scrape of phase46_crispri_vulnerability.py).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Cytochromes P450 are a group of heme-thiolate monooxygenases. They oxidize a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. |
|---|---|
| Mycobrowser EC |
1.14.-.-
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1813c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_2666
· 75.9% identity |
| M. orygis |
RJtmp_001859
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WPL3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Cytochrome P450 143 |
| EC (curated) |
EC 1.14.-.-
|
| Curated function | Cytochrome P450 that accepts electrons from the iron-sulfur ferredoxin FdxE encoded by an adjacent gene. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | cyp143 |
| eggNOG description | cytochrome P-450 |
| Orthologous group | COG2124 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.278 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| M. canettii dN/dS (deep-divergence selection) |
0.05
· 8 consensus substitution(s) under purifying selection vs M. canettii (deep divergence; dN/dS=0.05) — a real, constrained gene predating the MTBC clonal expansion |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 71.9%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 2/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 33.7% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) |
22 in the ORF —
0 in the essential state,
0 growth-defect,
22 non-essential,
0 growth-advantage.
Saturation 1.000,
mean read count 68.4545454545.
A region of the protein devoid of TA sites is invisible to this assay: nothing can be
inferred about it, in either direction.
All 22 sites lie in this ORF alone (no overlapping CDS shares any), so the call is attributable to this gene. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 12 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 13.4 ppm · rank 2551/3519 (27.5th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 393 aa |
|---|---|
| Molecular weight | 43.5 kDa |
| Theoretical pI | 6.33 |
| GRAVY | -0.075 (hydrophilic) |
| Aliphatic index | 96.8 |
| Aromaticity | 0.074 |
| Instability index | 56.3 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
p450 | PF00067.28 | 1.8e-09 | 206–313 | Cytochrome P450 |
Experimental structures (Protein Data Bank) 3 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
8amo |
X-ray diffraction | 1.4 Å | 100% |
8ckn |
X-ray diffraction | 1.54 Å | 100% |
8amq |
X-ray diffraction | 1.6 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (3 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8amq-assembly1_A |
1.00 | 0.97 | 1.6e-56 sig | 8amq-assembly1_A Crystal structure of the complex CYP143-FdxE from M. tuberculosis |
8ckn-assembly1_A |
1.00 | 0.98 | 3.5e-56 sig | 8ckn-assembly1_A Cytochrome P450 CYP143A1 (Rv1785c) from Mycobacterium tuberculosis |
6gmf-assembly1_A |
1.00 | 0.88 | 7.5e-23 sig | 6gmf-assembly1_A Structure of Cytochrome P450 CYP109Q5 from Chondromyces apiculatus |
5xw2-assembly1_A |
1.00 | 0.86 | 7.2e-23 sig | 5xw2-assembly1_A Crystal structure of the Hydroxylase HmtN in C 1 2 1 crystal form |
4e2p-assembly1_A |
1.00 | 0.86 | 3.8e-23 sig | 4e2p-assembly1_A Crystal Structure of a Post-tailoring Hydroxylase (HmtN) Involved in the Himastatin Biosynthesis |
Foldseek search of the AlphaFold DB model (mean pLDDT 93.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | eccC5 (+ strand, 14 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1786 (+ strand, 199 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv0081 (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a physiological-context lead, not a function.
Condition: Condition-blind by construction. These edges come from transcription-factor OVEREXPRESSION in a single laboratory condition, so a listed regulator is not a claim that it governs this gene in every circumstance. Measured counter-examples exist within this atlas (see Rv2516c, where the DosR regulon collapses under moxifloxacin while the gene itself rises). Read a regulator as 'capable of shifting this gene', and look for the condition before building a hypothesis on it.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv1786 (ferredoxin), high confidence from genomic context alone (score 743 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3800c pks13 exp |
polyketide synthase | 943 | 938 | experimental:891 |
Rv1937 exp |
oxygenase | 838 | 815 | experimental:478 |
Rv2380c mbtE exp |
peptide synthetase | 809 | 800 | experimental:689 |
Rv2776c |
oxidoreductase | 761 | 747 | |
Rv1786 |
ferredoxin | 884 | 743 ctx | neighborhood:707 textmining:569 |
Rv1666c cyp139 |
cytochrome P450 Cyp139 | 871 | 716 ctx | cooccurence:714 textmining:567 |
Rv0719 rplF exp |
50S ribosomal protein L6 | 691 | 691 | experimental:412 database:493 |
Rv1629 polA exp |
DNA polymerase I | 706 | 688 | database:638 |
Rv2946c pks1 exp |
polyketide synthase | 716 | 681 | experimental:460 |
Rv3554 fdxB |
electron transfer protein FdxB | 704 | 668 | |
Rv1151c cobB exp |
NAD-dependent protein deacylase | 664 | 665 | database:556 |
Rv1394c cyp132 |
cytochrome P450 Cyp132 | 831 | 664 ctx | cooccurence:662 textmining:518 |
Rv2932 ppsB exp |
phthiocerol synthesis polyketide synthase type I PpsB | 682 | 662 | experimental:460 |
Rv2940c mas |
multifunctional mycocerosic acid synthase | 695 | 661 | |
Rv1527c pks5 |
polyketide synthase | 694 | 660 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: cytochrome P450 Cyp143
- MTBC0 PGAP product: cytochrome P450
- Pfam (hmmscan --cut_ga): p450 PF00067.28 (E=2e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216301.1)
- Domains: Pfam-A via hmmscan --cut_ga — p450 (PF00067.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2124 - Curated reference: UniProt P9WPL3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
124 functional partner(s); context anchor
Rv1786 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001898|Rv1785c|cyp143 MTTPGEDHAGSFYLPRLEYSTLPMAVDRGVGWKTLRDAGPVVFMNGWYYLTRREDVLAALRNPKVFSSRKALQPPGNPLPVVPLAFDPPEHTRYRRILQPYFSPAALSKALPSLRRHTVAMIDAIAGRGECEAMADLANLFPFQLFLVLYGLPLEDRDRLIGWKDAVIAMSDRPHPTEADVAAARELLEYLTAMVAERRRNPGPDVLSQVQIGEDPLSEIEVLGLSHLLILAGLDTVTAAVGFSLLELARRPQLRAMLRDNPKQIRVFIEEIVRLEPSAPVAPRVTTEPVTVGGMTLPAGSPVRLCMAAVNRDGSDAMSTDELVMDGKVHRHWGFGGGPHRCLGSHLARLELTLLVGEWLNQIPDFELAPDYAPEIRFPSKSFALKNLPLRWS
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for cyp143? Email the maintainer — the message is pre-filled with this gene's details.