cyp143 Resolved · high auto-curated

H37Rv Rv1785c · MTBC0 mtbc0_001898 · 393 aa · 2041458–2042639 (-) · RefSeq NP_216301.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cytochrome P450 Cyp143
MTBC0 PGAP re-annotationcytochrome P450
Revised (this work)Cytochrome P450. Pfam: p450 (PF00067.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPL3 SwissProt · reviewed · Evidence at protein level
UniProt nameCytochrome P450 143
EC (curated) EC 1.14.-.-
Curated functionCytochrome P450 that accepts electrons from the iron-sulfur ferredoxin FdxE encoded by an adjacent gene.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namecyp143
eggNOG descriptioncytochrome P-450
Orthologous groupCOG2124

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.278 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
p450PF00067.28 1.8e-09206–313 Cytochrome P450

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1786 (ferredoxin), high confidence from genomic context alone (score 743 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3800c pks13 polyketide synthase 943 938 experimental:891
Rv1937 oxygenase 838 815 experimental:478
Rv2380c mbtE peptide synthetase 809 800 experimental:689
Rv2776c oxidoreductase 761 747
Rv1786 ferredoxin 884 743 ctx neighborhood:707 textmining:569
Rv1666c cyp139 cytochrome P450 Cyp139 871 716 ctx cooccurence:714 textmining:567
Rv0719 rplF 50S ribosomal protein L6 691 691 experimental:412 database:493
Rv1629 polA DNA polymerase I 706 688 database:638
Rv2946c pks1 polyketide synthase 716 681 experimental:460
Rv3554 fdxB electron transfer protein FdxB 704 668
Rv1151c cobB NAD-dependent protein deacylase 664 665 database:556
Rv1394c cyp132 cytochrome P450 Cyp132 831 664 ctx cooccurence:662 textmining:518
Rv2932 ppsB phthiocerol synthesis polyketide synthase type I PpsB 682 662 experimental:460
Rv2940c mas multifunctional mycocerosic acid synthase 695 661
Rv1527c pks5 polyketide synthase 694 660

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: cytochrome P450 Cyp143
  • MTBC0 PGAP product: cytochrome P450
  • Pfam (hmmscan --cut_ga): p450 PF00067.28 (E=2e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216301.1)
  • Domains: Pfam-A via hmmscan --cut_ga — p450 (PF00067.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2124
  • Curated reference: UniProt P9WPL3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 124 functional partner(s); context anchor Rv1786
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001898|Rv1785c|cyp143
MTTPGEDHAGSFYLPRLEYSTLPMAVDRGVGWKTLRDAGPVVFMNGWYYLTRREDVLAALRNPKVFSSRKALQPPGNPLPVVPLAFDPPEHTRYRRILQPYFSPAALSKALPSLRRHTVAMIDAIAGRGECEAMADLANLFPFQLFLVLYGLPLEDRDRLIGWKDAVIAMSDRPHPTEADVAAARELLEYLTAMVAERRRNPGPDVLSQVQIGEDPLSEIEVLGLSHLLILAGLDTVTAAVGFSLLELARRPQLRAMLRDNPKQIRVFIEEIVRLEPSAPVAPRVTTEPVTVGGMTLPAGSPVRLCMAAVNRDGSDAMSTDELVMDGKVHRHWGFGGGPHRCLGSHLARLELTLLVGEWLNQIPDFELAPDYAPEIRFPSKSFALKNLPLRWS