hpt Resolved · high auto-curated

H37Rv Rv3624c · MTBC0 mtbc0_003841 · 216 aa · 4086958–4087608 (-) · RefSeq NP_218141.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypoxanthine-guanine phosphoribosyltransferase
MTBC0 PGAP re-annotationhypoxanthine phosphoribosyltransferase
Revised (this work)Hypoxanthine phosphoribosyltransferase. Pfam: Pribosyltran (PF00156.34).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHQ9 SwissProt · reviewed · Evidence at protein level
UniProt nameHypoxanthine-guanine phosphoribosyltransferase
EC (curated) EC 2.4.2.8
Curated functionPurine salvage pathway enzyme that catalyzes the transfer of the ribosyl-5-phosphate group from 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to the N9 position of the 6-oxopurines hypoxanthine and guanine to form the corresponding ribonucleotides IMP (inosine 5'-monophosphate) and GMP (guanosine 5'-monophosphate), with the release of PPi. Thus, specifically recycles hypoxanthine and guanine imported from the external medium, and converts them to IMP and GMP, respectively. Cannot use xanthine as substrate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namehpt
eggNOG descriptionBelongs to the purine pyrimidine phosphoribosyltransferase family
Orthologous groupCOG0634
EC number EC 2.4.2.8
KEGG orthology K00760
KEGG pathways map00230, map00983, map01100, map01110
Gene Ontology (79) GO:0003674, GO:0003824, GO:0004422, GO:0006139, GO:0006163, GO:0006164, GO:0006177, GO:0006188, GO:0006725, GO:0006753, GO:0006793, GO:0006796 +67 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.888 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PribosyltranPF00156.34 2.7e-2148–197 Phosphoribosyl transferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mesJ (tRNA(Ile)-lysidine synthase), high confidence from genomic context alone (score 987 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3625c mesJ tRNA(Ile)-lysidine synthase 998 987 ctx neighborhood:881 fusion:855 textmining:888
Rv3396c guaA GMP synthase 973 940 database:900 textmining:587
Rv3307 deoD purine nucleoside phosphorylase 975 925 database:900 textmining:693
Rv1021 mazG nucleoside triphosphate pyrophosphohydrolase 923 923 database:900
Rv0357c purA adenylosuccinate synthetase 990 921 database:900 textmining:882
Rv2584c apt adenine phosphoribosyltransferase 993 917 database:900 textmining:922
Rv0733 adk adenylate kinase 940 916 ctx fusion:887
Rv1389 gmk guanylate kinase 963 915 database:900 textmining:593
Rv0957 purH bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosinemonophosphate cyclohydrolase 932 912 database:900
Rv3411c guaB2 inosine-5'-monophosphate dehydrogenase 990 910 database:900 textmining:893
Rv1341 rdgB non-canonical purine NTP pyrophosphatase 911 905 database:900
Rv1843c guaB1 inosine-5'-monophosphate dehydrogenase 934 904 database:900
Rv3410c guaB3 oxidoreductase 920 904 database:900
Rv3393 iunH nucleoside hydrolase 967 901 database:900 textmining:688
Rv3626c hyp hypothetical protein 982 882 ctx neighborhood:881 textmining:860

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypoxanthine-guanine phosphoribosyltransferase
  • MTBC0 PGAP product: hypoxanthine phosphoribosyltransferase
  • Pfam (hmmscan --cut_ga): Pribosyltran PF00156.34 (E=3e-21)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218141.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pribosyltran (PF00156.34)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0634
  • Curated reference: UniProt P9WHQ9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 38 functional partner(s); context anchor mesJ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003841|Rv3624c|hpt
MTPALVVGPAAWHAVHVTQSSSAITPGQTAELYPGDIKSVLLTAEQIQARIAELGEQIGNDYRELSATTGQDLLLITVLKGAVLFVTDLARAIPVPTQFEFMAVSSYGSSTSSSGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ