hpt Resolved · high auto-curated
H37Rv Rv3624c · MTBC0 mtbc0_003841 ·
216 aa ·
4086958–4087608 MTBC0
(-) ·
RefSeq NP_218141.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypoxanthine-guanine phosphoribosyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | hypoxanthine phosphoribosyltransferase |
| Revised (this work) | Hypoxanthine phosphoribosyltransferase. Pfam: Pribosyltran (PF00156.34). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 18 publications
18 TB publications mention this gene. 18 publication(s) discuss this gene (20 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| The association between dietary inflammatory index and latent tuberculosis infection: Confounding role of country of birth. doi:10.1016/j.clinsp.2026.100937 | 2026 |
| Non-communicable diseases and resistant tuberculosis, a growing burden among people living with HIV in Eastern Kenya. doi:10.1371/journal.pgph.0004212 | 2025 |
| Two-stage treatment for severe spinal kyphotic deformity secondary to tuberculosis: halo-pelvic traction followed by a posterior-only approach correction. doi:10.1186/s12891-022-05974-7 | 2022 |
| Discovery of multi-target mur enzymes inhibitors with anti-mycobacterial activity through a Scaffold approach. doi:10.1080/07391102.2022.2040593 | 2023 |
| Bayesian estimation of prevalence of Johne's disease in dairy herds in Southern Italy. doi:10.1016/j.prevetmed.2021.105552 | 2022 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | tilS (Rv3625c, - strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -8.11 (95% CI -9.47 to -6.89). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in purine salvage [catalytic activity: imp + pyrophosphate = hypoxanthine + 5-phospho-alpha-D-ribose 1-diphosphate (guanine can replace hypoxanthine to produce GMP)]. |
|---|---|
| Mycobrowser EC |
2.4.2.8
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3648c
· 99.5% identity |
|---|---|
| M. leprae |
ML0214
· 83.1% identity |
| M. marinum |
MMAR_5124
· 88.1% identity |
| M. smegmatis |
MSMEG_6110
· 72.9% identity |
| M. orygis |
RJtmp_003724
· 99.5% identity |
| M. abscessus |
MAB_0523
· 72.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHQ9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Hypoxanthine-guanine phosphoribosyltransferase |
| EC (curated) |
EC 2.4.2.8
|
| Curated function | Purine salvage pathway enzyme that catalyzes the transfer of the ribosyl-5-phosphate group from 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to the N9 position of the 6-oxopurines hypoxanthine and guanine to form the corresponding ribonucleotides IMP (inosine 5'-monophosphate) and GMP (guanosine 5'-monophosphate), with the release of PPi. Thus, specifically recycles hypoxanthine and guanine imported from the external medium, and converts them to IMP and GMP, respectively. Cannot use xanthine as substrate. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| Preferred name | hpt |
| eggNOG description | Belongs to the purine pyrimidine phosphoribosyltransferase family |
| Orthologous group | COG0634 |
| EC number |
EC 2.4.2.8
|
| KEGG orthology |
K00760
|
| KEGG pathways |
map00230, map00983, map01100, map01110
|
| Gene Ontology (79) |
GO:0003674, GO:0003824, GO:0004422, GO:0006139, GO:0006163, GO:0006164, GO:0006177, GO:0006188, GO:0006725, GO:0006753, GO:0006793, GO:0006796 +67 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.888 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 86.1%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 58.7% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 12 in the ORF — 10 in the essential state, 0 growth-defect, 2 non-essential, 0 growth-advantage. Saturation 0.167, mean read count 82. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | hpt (TetON promoter NA) |
|---|---|
| Baseline knockdown fitness | 4.075 median doublings (across 1 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | no (Excluded - not in all screening waves) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 78.4 ppm · rank 1466/3519 (58.4th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 216 aa |
|---|---|
| Molecular weight | 23.6 kDa |
| Theoretical pI | 4.92 |
| GRAVY | 0.059 (hydrophobic) |
| Aliphatic index | 107.4 |
| Aromaticity | 0.074 |
| Instability index | 26.3 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Pribosyltran | PF00156.34 | 2.7e-21 | 48–197 | Phosphoribosyl transferase domain |
Experimental structures (Protein Data Bank) 7 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
4rhx |
X-ray diffraction | 2.0322 Å | 99% |
4rhy |
X-ray diffraction | 2.3196 Å | 99% |
5knp |
X-ray diffraction | 2.45 Å | 99% |
5knq |
X-ray diffraction | 2.553 Å | 99% |
4rhu |
X-ray diffraction | 2.573 Å | 99% |
4rht |
X-ray diffraction | 2.7633 Å | 99% |
5kny |
X-ray diffraction | 2.91 Å | 99% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (7 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 89.2
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5kny-assembly1_B |
1.00 | 0.97 | 3.7e-34 sig | 5kny-assembly1_B Crystal structure of Mycobacterium tuberculosis hypoxanthine guanine phosphoribosyltransferase in complex with (3-((3R,4R)-3-(Guanin-9-yl)-4-((S)-2-hydroxy-2-phosphonoethoxy)pyrrolidin-1-yl)-3-oxopropyl)phosphonic acid |
4rhx-assembly2_A |
1.00 | 0.97 | 1.4e-33 sig | 4rhx-assembly2_A Structures of Mycobacterium tuberculosis 6-oxopurine phosphoribosyltransferase which is a potential target for drug development against this disease |
5knp-assembly3_D |
1.00 | 0.98 | 5.0e-33 sig | 5knp-assembly3_D Crystal structure of Mycobacterium tuberculosis hypoxanthine guanine phosphoribosyltransferase in complex with [3S,4R]-(4-(Hypoxanthin-9-yl)pyrrolidin-3-yl)-oxymethanephosphonic acid |
5knp-assembly3_C |
1.00 | 0.98 | 4.7e-33 sig | 5knp-assembly3_C Crystal structure of Mycobacterium tuberculosis hypoxanthine guanine phosphoribosyltransferase in complex with [3S,4R]-(4-(Hypoxanthin-9-yl)pyrrolidin-3-yl)-oxymethanephosphonic acid |
4rhy-assembly3_D |
1.00 | 0.97 | 8.6e-33 sig | 4rhy-assembly3_D Crystal structures of Mycobacterium tuberculosis 6-oxopurine phosphoribosyltransferase which is a potential target for drug development against this disease |
Foldseek search of the AlphaFold DB model (mean pLDDT 89.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | lpqG (+ strand, 4 bp gap) |
|---|---|
| Downstream (3' on genome) | mesJ (- strand, -4 bp gap) |
| Predicted operon |
hpt · mesJ · Rv3626c · Rv3627c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: mesJ (tRNA(Ile)-lysidine synthase), high confidence from genomic context alone (score 987 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3625c mesJ |
tRNA(Ile)-lysidine synthase | 998 | 987 ctx | neighborhood:881 fusion:855 textmining:888 |
Rv3396c guaA exp |
GMP synthase | 973 | 940 | database:900 textmining:587 |
Rv3307 deoD exp |
purine nucleoside phosphorylase | 975 | 925 | database:900 textmining:693 |
Rv1021 mazG exp |
nucleoside triphosphate pyrophosphohydrolase | 923 | 923 | database:900 |
Rv0357c purA exp |
adenylosuccinate synthetase | 990 | 921 | database:900 textmining:882 |
Rv2584c apt exp |
adenine phosphoribosyltransferase | 993 | 917 | database:900 textmining:922 |
Rv0733 adk |
adenylate kinase | 940 | 916 ctx | fusion:887 |
Rv1389 gmk exp |
guanylate kinase | 963 | 915 | database:900 textmining:593 |
Rv0957 purH exp |
bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosinemonophosphate cyclohydrolase | 932 | 912 | database:900 |
Rv3411c guaB2 exp |
inosine-5'-monophosphate dehydrogenase | 990 | 910 | database:900 textmining:893 |
Rv1341 rdgB exp |
non-canonical purine NTP pyrophosphatase | 911 | 905 | database:900 |
Rv1843c guaB1 exp |
inosine-5'-monophosphate dehydrogenase | 934 | 904 | database:900 |
Rv3410c guaB3 exp |
oxidoreductase | 920 | 904 | database:900 |
Rv3393 iunH exp |
nucleoside hydrolase | 967 | 901 | database:900 textmining:688 |
Rv3626c hyp |
hypothetical protein | 982 | 882 ctx | neighborhood:881 textmining:860 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypoxanthine-guanine phosphoribosyltransferase
- MTBC0 PGAP product: hypoxanthine phosphoribosyltransferase
- Pfam (hmmscan --cut_ga): Pribosyltran PF00156.34 (E=3e-21)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218141.1)
- Domains: Pfam-A via hmmscan --cut_ga — Pribosyltran (PF00156.34)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0634 - Curated reference: UniProt P9WHQ9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 89.2)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
38 functional partner(s); context anchor
mesJ - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003841|Rv3624c|hpt MTPALVVGPAAWHAVHVTQSSSAITPGQTAELYPGDIKSVLLTAEQIQARIAELGEQIGNDYRELSATTGQDLLLITVLKGAVLFVTDLARAIPVPTQFEFMAVSSYGSSTSSSGVVRILKDLDRDIHGRDVLIVEDVVDSGLTLSWLSRNLTSRNPRSLRVCTLLRKPDAVHANVEIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRVYQ
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for hpt? Email the maintainer — the message is pre-filled with this gene's details.