Rv3629c Family assigned · medium auto-curated

H37Rv Rv3629c · MTBC0 mtbc0_003846 · 365 aa · 4091661–4092758 (-) · RefSeq NP_218146.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotationDUF475 domain-containing protein
Revised (this work)DUF475 domain-containing protein. Pfam: TerC (PF03741.23), DUF475 (PF04332.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06378 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved integral membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF475)
Orthologous groupCOG2899
KEGG orthology K09799

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.09 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.34% of strains (495) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TerCPF03741.23 4.5e-1436–321 Integral membrane protein TerC family
DUF475PF04332.22 1.9e-14345–355 Protein of unknown function (DUF475)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3630 (integral membrane protein), high confidence from genomic context alone (score 708 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3630 integral membrane protein 960 708 ctx neighborhood:704 textmining:870
Rv3631 transferase 956 677 ctx neighborhood:674 textmining:870
Rv3632 membrane protein 952 651 ctx neighborhood:646 textmining:870
Rv0180c transmembrane protein 579 579 ctx cooccurence:578
Rv0824c desA1 acyl-ACP desaturase DesA 427 427 ctx cooccurence:402
Rv3718c hyp hypothetical protein 418 418 ctx cooccurence:417
Rv0090 membrane protein 416 416 ctx cooccurence:416
Rv3633 hyp hypothetical protein 903 286 textmining:870
Rv3623 lpqG lipoprotein LpqG 512 167 textmining:439

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: integral membrane protein
  • MTBC0 PGAP product: DUF475 domain-containing protein
  • Pfam (hmmscan --cut_ga): TerC PF03741.23 (E=4e-14), DUF475 PF04332.22 (E=2e-143)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218146.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TerC (PF03741.23), DUF475 (PF04332.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2899
  • Curated reference: UniProt O06378 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 9 functional partner(s); context anchor Rv3630
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003846|Rv3629c|
MSTFRIFGFSLLMTVVALVTGYLHGGPTALFLLAVLALLEVSLSFDNAIINAAILQRMSPFWQRMFLTIGILIAVFGMRLVFPLAIIWTTAGLDPVRAMELALRPPAHGALEFADGSPSYEKLITAAHPQIAAFGGMFLLMLFLDFVVHDRDIKWLKWIEVPFARIGRLGQVPVIVASVGLVLAGALLTHSSDQRGTVLIAGLLGMVTYLVVNGISRAFRPAGLGEATPGVQARQAAGKAGCALFLYLEVLDAAFSFDGVTGAFAITTDPIIIALGLGVVGAMFVRSITIYLVRQDTLDRYVYLEHGAHWAIGALAIILLLSIDHRFAVPEWVTASVGVVFIGAAFTESVRRNRLTVRSPTKFGS